KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_0019Help
Entry
YPC_0019          CDS       T01874                                 

Gene name
metA
Definition
(GenBank) homoserine transsuccinylase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph00270  Cysteine and methionine metabolism
yph00920  Sulfur metabolism
yph01100  Metabolic pathways
yph01110  Biosynthesis of secondary metabolites
yph01130  Biosynthesis of antibiotics
yph01230  Biosynthesis of amino acids
Module
yph_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:yph00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    YPC_0019 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YPC_0019 (metA)
Enzymes [BR:yph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     YPC_0019 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     YPC_0019 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: ADV96794
Position
18389..19318
Genome map
AA seq 309 aa AA seqDB search
MPIRVPDELPAVSFLRNENVFVMASSRAKTQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQNFDGLIVTGAPLGLVDFCDVAY
WPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVKLSGIYQHQTLEPLALLT
RGFDETFLAPHSRYADFPVEVLQQYTDLDILVSSEEAGAYLFASKDKRVAFVTGHPEYDV
DTLAGEYQRDLAAGLNPQVPLNYFPSDDASLRPKASWRSHGHLLFANWLNYYVYQITPFD
LRHMNPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcgggttcctgatgaattacctgcagtgagtttcttgcgcaatgagaatgtt
tttgtgatggcttcatcgcgtgctaaaactcaggaaattcggcccctgaaggtattgatt
ttaaatctgatgcctaaaaaaattgagacggagaatcaattcctacgtttactctctaac
tcgccactccaggttgatattcaattgttgagggttgatagtcgtgagtctaaaaatacg
cctacggagcatctgaacaacttttactgcgattttgaggacattcaggaccagaatttt
gatggcttgatcgtaaccggcgctcctctgggtttagtcgatttctgtgatgtggcttat
tggccacaaattgaacgtattattgcctgggcaaaagagcatgtgacatcaactctattt
gtctgttgggcggtgcaggcggcgttaaatatcttgtatggcatcccgaagatgacgcgc
gaggtcaaactctctggtatctatcagcatcaaacactcgaaccgctggccttattgacg
cgtggttttgatgaaacatttctggctcctcattcccgctatgctgattttcccgttgaa
gtccttcaacaatatactgatttggatatcttagtgtcgtcagaagaggctggggcttat
ctgtttgccagtaaagataagcgggtggcttttgttaccggtcatcccgagtatgatgtc
gatacgttagcgggtgaatatcagcgtgatctggctgcaggccttaacccacaagttcct
cttaattatttcccttctgacgatgcatcgttacgaccaaaagcatcatggcgcagtcat
gggcatctactgtttgccaattggctcaactactatgtttaccaaattacgccatttgat
ttgcgacatatgaatcctacccttgattga

DBGET integrated database retrieval system