KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_0247Help
Entry
YPC_0247          CDS       T01874                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
yph00010  Glycolysis / Gluconeogenesis
yph00051  Fructose and mannose metabolism
yph00562  Inositol phosphate metabolism
yph01100  Metabolic pathways
yph01110  Biosynthesis of secondary metabolites
yph01120  Microbial metabolism in diverse environments
yph01130  Biosynthesis of antibiotics
yph01200  Carbon metabolism
yph01230  Biosynthesis of amino acids
Module
yph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yph_M00002  Glycolysis, core module involving three-carbon compounds
yph_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPC_0247 (tpiA)
   00051 Fructose and mannose metabolism
    YPC_0247 (tpiA)
   00562 Inositol phosphate metabolism
    YPC_0247 (tpiA)
Enzymes [BR:yph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YPC_0247 (tpiA)
Exosome [BR:yph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YPC_0247 (tpiA)
  Exosomal proteins of bladder cancer cells
   YPC_0247 (tpiA)
  Exosomal proteins of melanoma cells
   YPC_0247 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADV97010
Position
complement(230326..231093)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system