KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_1190Help
Entry
YPC_1190          CDS       T01874                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
yph00010  Glycolysis / Gluconeogenesis
yph00052  Galactose metabolism
yph01100  Metabolic pathways
yph01110  Biosynthesis of secondary metabolites
yph01120  Microbial metabolism in diverse environments
yph01130  Biosynthesis of antibiotics
Module
yph_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPC_1190
   00052 Galactose metabolism
    YPC_1190
Enzymes [BR:yph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     YPC_1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADV97844
Position
complement(1181394..1182290)
Genome map
AA seq 298 aa AA seqDB search
MLLGYPTPADYLHQAAYLGATVGRYANRIANAQITLDGETIQLVPNQGPNQLHGGPEGFH
AQRWQKVTQDDHQVTYKLDSPDGDQGFPGNLTVEVQYLLTEDNRLEIHYQAQVDKTCPVN
LTNHAYFNLDGEGHDARSHRLQLFADRYLPVDSAGIPTGGLADVENTGMDFRQPKTLAQD
FLQDRCQQRVKGYDHAYLLHRTCGALDSPAAHLWSSDNQVQMSMFTSAPALQLYSGNYLA
GTPARNGGTYASYAGVALESEFLPDSPNHPEWPQPDCWLKPGKTYRSTTVYHFIALPL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgctactgggctacccgacaccggctgattacctgcatcaagccgcttatctcggggcc
acggttggccgttatgccaaccggatagccaatgcgcaaatcaccttggatggcgaaaca
atccagttggtcccgaaccaaggccctaaccaattacacggtggcccggaaggtttccat
gcccagcgttggcagaaagtgacccaagatgaccaccaggttacctataaacttgattca
ccagatggcgatcaaggtttccccggtaatctgactgttgaagtacagtacctgctaacc
gaagataaccggctggaaattcattatcaggcacaggtggataaaacctgcccggttaac
ctgaccaatcatgcctatttcaaccttgacggcgaagggcatgatgcccgttcacatcgt
ttgcaactgtttgcagaccgttacctgcctgtcgacagtgcgggcatcccaaccggagga
ctcgctgatgtcgagaataccggtatggattttcgccaacctaaaacattggcgcaggat
tttctacaagatcgctgccagcaacgagttaaaggctatgaccacgcttatttgctgcac
cgcacctgtggggccttagactctccggcggcacacttgtggtcatccgataaccaggtg
caaatgagtatgttcacctcagcgcctgcgttgcagctttacagcggaaattatcttgct
ggcacacccgcacgcaacggcggcacctatgccagctatgcgggtgtggcactagaaagt
gaatttttgcctgatagccctaaccaccctgaatggccacagcccgattgttggctaaaa
ccggggaagacctatcgctcaacgacggtttatcactttattgcgttgcctttataa

DBGET integrated database retrieval system