KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_1461Help
Entry
YPC_1461          CDS       T01874                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yph00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPC_1461
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yph02044]
    YPC_1461
Secretion system [BR:yph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPC_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ADV98084
Structure
PDB: 

Position
1435432..1435917
Genome map
AA seq 161 aa AA seqDB search
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAH
YIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETR
PREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagatatgtttatcaaaattgatggtattgaaggtgagtctttggatgccaat
cacaaaaacgaaatccaggtattagcttggaactgggatgttgctcaacactcgaatatg
cacagcggttcaggtggcggttcaggtaaagcctctgtttcagatttttgcttcgcacat
tatatcgataaagctagcccgaacttattgagctattgcttgttgggtaagcacattaaa
aatgttcagttcgtactgcgtaaagctggtggcgatccgctggaatatctgacaattaaa
tttaccgatgtcatcattactcgtgttgatatggcgggttctttggaagatgaaacgcgt
ccacgtgaagaaattcgtttctcattcactaagatgactcaggactatgttatgcagaat
gctgaaggccataagtctggcgttatttctgctaactacgatgttaaagctaacatgcac
agctaa

DBGET integrated database retrieval system