KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_1462
Entry
YPC_1462          CDS       T01874                                 

Definition
(GenBank) putative exported protein precursor
  KO
K11906  type VI secretion system protein VasD
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yph00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPC_1462
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yph02044]
    YPC_1462
Secretion system [BR:yph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPC_1462
SSDB
Motif
Pfam: T6SS-SciN DUF4969
Other DBs
NCBI-ProteinID: ADV98085
Position
1436170..1436730
AA seq 186 aa
MILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPND
KGVANPLRIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTL
DAGVTAIGIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSI
SIKEMD
NT seq 561 nt   +upstreamnt  +downstreamnt
atgattttaattaggctaagtatgaataaaagtatccgaggggtttaccgggcgacacag
tacttatttttggtactggtaacgttattgacgatagcctgtagttcaaaagtgcaacct
gaaaaggctgaaaagcttaccgtcgaaatcgcgacagcagcggatattaatccgaatgat
aaaggggtggcgaacccgctaaggattgcactttatacactcaagagcaccgatgaattt
cagtcgagtgatttcttcactatcactgaagaaaatacgccatcgctaaaagaacaaatg
gataacgtgtttgaccggattatgttgccaagcgagaccaaaaaaatagagctgacactt
gatgctggcgttactgctatcggcatcgtggctgcttatcgtgaaattgaacaggcggag
tggaaagcggttatttatccgttgcccaaaaaacgcgtggatccttggtataaaaaaatg
tggccagggcaagaccaacaagatccgatcatgaaggtacgcgttgagcgtctgtcaata
tcaattaaagaaatggattaa

DBGET integrated database retrieval system