KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_1463
Entry
YPC_1463          CDS       T01874                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Brite
KEGG Orthology (KO) [BR:yph00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yph02044]
    YPC_1463
Secretion system [BR:yph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPC_1463
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ADV98086
Position
1436734..1438083
AA seq 449 aa
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLV
LRSGKGVLPDGTPFDIPGHAELPEPLTITPEHLGKLIYLAVPLRLDNSDETIFDEHDMSS
LARFYAYEAALNDTNAIRQGPKPVQLSRLRLRLVSEGEMTESWIGLPLTKVRAIQPDGSV
LLHTEDYIPPVTGYAASSLLSEWLTHLNGLVKMRAEMLANRLSNSDGKASASAEIVDYLL
LQIFNKYEPILDHLRHIPELPPITLYQELAKFSGELSTFIRTKTRRPRPAPGYDHAKLYA
SIRPLVDEVHELLNQILVRAGQMIPLETKGNGVWSASVLPNELRSFSNLVLAVHAQLPMD
VLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELIKNGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
NT seq 1350 nt   +upstreamnt  +downstreamnt
gtgagaactaacaaagtcgtttggagtgaggggctttttcttcgcccacaactttttcaa
cagcaagagcgctatcttgaatattacgcccataagcgagctgcaacgataaccccattc
ttttggggatttgcgcaatatgaaattgatagagaagcactctcgtatggcaaattagta
ttgcgatctgggaagggcgtgttacccgacggtacaccatttgatattcccggccatgct
gaattgcctgaaccgctcactatcaccccagaacatctgggtaagttgatctatctggcg
gtaccactgcgcctggataacagtgatgaaaccatttttgatgagcacgatatgagctca
ttggcacgtttttacgcctatgaagctgcgctcaacgataccaatgccattcggcaaggg
ccgaagccggtacaactgtcaagattacgtctcagattagtctcagaaggtgagatgaca
gaatcatggattgggctgccattaaccaaagtcagagcgattcagcctgatgggagtgtc
ttgctacacaccgaagactatattcctccggtgacgggttatgccgcaagttcattgctg
tctgaatggctaacccatcttaatggtttggttaaaatgcgcgcagagatgttggccaat
cgcttgtcaaacagtgatgggaaagcgagcgccagcgcagaaattgtcgattatttgtta
ctgcaaatttttaataaatatgagccgattctcgatcatttaaggcatattcctgaatta
ccgcctattacgctttatcaggaattggctaagttctcgggggaattatctacctttatc
cggaccaaaacccgccgaccccgcccggcacctggctatgatcatgcgaagctctatgcg
tctattcgtccgttggttgacgaagttcatgaactactgaaccagatcttggtgcgtgct
gggcagatgataccgctggagacgaaaggcaatggcgtttggtctgcctccgtactgcct
aatgaattacgctcgttttcaaatctggtccttgccgttcatgcgcaattaccgatggat
gtgctacagcatcaattttcagtacaaacaaaaatcagcgcacctcagcaattgcatgaa
ctggtgcgatcgcatttgccagggttggaactacagcgtttgccggtaccgcccagacaa
attccgtatagcgcagggtacgtttattttgaattgataaaaaatggccccttctgggac
aaagtttccaatgctggtgccattgccctgcatgtggcgggtgatttccctgccttgaaa
atggagctctgggggattagagattcatga

DBGET integrated database retrieval system