KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_2609Help
Entry
YPC_2609          CDS       T01874                                 

Gene name
gnd
Definition
(GenBank) gluconate-6-phosphate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph00030  Pentose phosphate pathway
yph00480  Glutathione metabolism
yph01100  Metabolic pathways
yph01110  Biosynthesis of secondary metabolites
yph01120  Microbial metabolism in diverse environments
yph01130  Biosynthesis of antibiotics
yph01200  Carbon metabolism
Module
yph_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
yph_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:yph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPC_2609 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YPC_2609 (gnd)
Enzymes [BR:yph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     YPC_2609 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     YPC_2609 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH 3HCDH_N ApbA NAD_binding_11 IlvN 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADV99162
Position
complement(2512293..2513702)
Genome map
AA seq 469 aa AA seqDB search
MSKQQIGVVGMAVMGRNLALNIESRGYSVSIFNRSSDKTDEVVAENPGKNLVPSYTVEEF
VDSLEKPRRILLMVKAGEATDKTIASLTPHLDKGDILIDGGNTYYKDTIRRNRELSAQGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILEKIAARADDGDACVAYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYSLLKQSLGLSNEELASTFAEWNKGELNSYLIDITKDIFT
KKDEDGNYLVDVILDEAANKGTGKWTSQSSLDLGEPLTLITESVFARYLSSLKDQRVAAS
KVLTGPKVQPFTGDKAEFIEKIRRALYLGKIVSYAQGFSQLKAASNENNWDLNYGEIAKI
FRAGCIIRAQFLQKITDAYAENADIANLLLAPYFKQIADEYQQALRDVVSYAVQNGIPTP
TFSAAINYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWMA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaacagatcggcgttgtcggtatggcggtgatgggccgtaacctggcgctc
aacatcgaaagccgtggctattccgtttctatttttaaccgttcatcagacaaaaccgac
gaagtggttgccgagaatccaggtaagaatctggtgccgagttataccgttgaagagttt
gttgattcactggaaaaaccgcgccgtatcctgctgatggtgaaagcgggtgaagcaaca
gataaaacgatcgcttcactgacgccgcatcttgataaaggcgatattctgattgatggt
ggcaatacttattacaaagacaccattcgtcgtaaccgtgaactttctgcacaaggcttt
aactttatcggtaccggcgtgtctggtggtgaagagggtgcattgaaaggcccttctatc
atgccgggtggccagaaagaagcctacgaattggttgccccgatccttgagaaaattgcg
gcccgtgctgatgatggtgacgcctgcgttgcctatatcggcgctgacggtgctggccat
tacgttaaaatggttcacaacggtatcgaatacggtgatatgcaattgatcgccgaagcc
tattcactgctgaaacagtctctgggtctgagcaatgaagagctggccagtacttttgct
gagtggaacaaaggcgaactgaacagctacctgattgatatcaccaaagacatcttcacc
aagaaagacgaagacggtaactatctggttgatgtgatcctggacgaagctgccaacaaa
ggcaccggtaaatggaccagccaaagttctctggacttgggtgagccgttaacactgatc
actgaatctgtgtttgcccgttacttgtcttctctgaaagatcaacgtgttgctgcctct
aaagtgttgactggccctaaagttcagcctttcactggtgataaagccgagtttatcgaa
aaaattcgtcgcgcgctgtatctgggtaaaatcgtttcttacgcacaaggtttctctcaa
ctgaaagcggcatctaacgagaataactgggatctgaattacggtgaaatcgcgaagatt
ttccgtgctggctgtattattcgtgctcagttcctacaaaaaattactgatgcttatgca
gaaaacgcagatatcgctaacttgctgctggcaccgtacttcaagcaaattgctgatgaa
taccagcaagcgctgcgtgatgtggtgtcttatgcggtacaaaacggtatcccaacgcca
acattctctgctgcgattaactattacgacagctaccgttcagccgtgctgcctgctaac
ttgatccaggcacagcgcgactatttcggtgcgcatacgtataagcggacagataaagaa
ggtgtattccacactgagtggatggcgtaa

DBGET integrated database retrieval system