KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_2687
Entry
YPC_2687          CDS       T01874                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yph00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPC_2687
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yph02044]
    YPC_2687
Secretion system [BR:yph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPC_2687
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADV99234
Position
complement(2605268..2605759)
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDNNTGKLTGTRIHTPFV
FTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNTKLENVKVVKVAPKMHD
VKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattccagtttatctgtggctgaaagacgacggcggtgcggacatcaagggttct
gttgatgtgcaaagccgtgaaggcagcattgagatcgtggcacaggaccataacctgtac
atcccaaccgataacaataccggcaaactgaccggtacccgtatccacaccccgttcgta
ttcaccaaagaaatcgatgcgtcgaccccgtacctgtacaaagcggtgaccaccggtcag
acactgaaaaccgccgagttcaaatggtaccgcattgatgacgctggccaggaagttgaa
tatttcaacaccaaactggaaaacgtcaaagtggttaaagttgcgccgaaaatgcacgac
gtgaaagatccggcgaaagagaagcacaaccacctggaactggtggaactgcgctacgaa
aaaatcacctggacctttaaagacggcaacatcattcattccgattcgtggaacgagcgc
gccaccgcatag

DBGET integrated database retrieval system