KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_4011
Entry
YPC_4011          CDS       T01874                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Brite
KEGG Orthology (KO) [BR:yph00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yph02044]
    YPC_4011
Secretion system [BR:yph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPC_4011
SSDB
Motif
Pfam: ImpA_N Inhibitor_I48 LptC
Other DBs
NCBI-ProteinID: ADW00442
Position
3870184..3871197
AA seq 337 aa
MILKRMDNNMSDIFPQALFGVEYDPAYGEIESILSQLDESADPLSRPHEPPQINWHHISE
QANKLLEQCFDLRVMLWFIRANIHIKGISALYDGFMRINAQTQDTDVVIYPQSEEPPLNS
GHAAALGWLSTAQCIAELKTARLTEEHPYILQDLITTEALPNGQERYFVTSSTLFLTVNN
YFQQNGLPDLKDQLTKVDMLLEQIESYANQSTESYQLHCEQLRIFLKNNISQLAQLNAPE
HDDPETVYQKIDSHESLDTQSFNSNDKSIRSRQEIIMMLDRILEYFQHYEPSHPAPIFIR
RTKEMIGMDFYSIVEEILPEAVITLKQFTGKTNLPFR
NT seq 1014 nt   +upstreamnt  +downstreamnt
ttgattttaaaacggatggacaataatatgagtgacatatttcctcaagcattattcggc
gttgaatatgatccggcctatggcgagattgagtccatcctctctcaattagatgagtct
gcggaccccctttcccgcccgcatgaaccccctcaaataaactggcaccatatcagtgag
caagccaataagctgctagagcaatgttttgatttacgtgtaatgctttggtttataagg
gcaaatattcatataaaaggaatatcggccctctatgatggctttatgcgcattaatgca
caaacccaagatactgatgttgttatctaccctcaatcggaagaaccgccattaaatagt
gggcatgccgccgcattaggttggttatctacagcacaatgtattgcagagcttaagact
gcacgccttacagaagagcacccttacattttacaagatcttattacgactgaagcgtta
cccaatggccaagagagatattttgttacatcttcgacattatttttaactgtcaataat
tatttccaacagaatggattgccagatttaaaagaccaattgacaaaagtagatatgttg
ttggaacaaattgagtcctatgcaaatcaatccacagagagttaccaactgcattgtgaa
caattacgtattttcttaaaaaataatatttctcagcttgcacaattgaatgccccagaa
catgacgatcccgaaactgtttatcaaaaaatagacagtcatgaatctcttgatactcag
tcctttaattcaaatgataagagcattcgctcacggcaagagatcattatgatgctggac
cgtattctagagtactttcaacattatgagcctagtcatccagccccaatattcattcgc
cgtaccaaagagatgataggtatggatttttattccattgttgaagaaattctgcctgaa
gctgtaattacattaaaacagtttaccggaaaaactaacctaccgtttcgatga

DBGET integrated database retrieval system