KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_4024Help
Entry
YPC_4024          CDS       T01874                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Pathway
yph03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yph00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YPC_4024
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yph02044]
    YPC_4024
Secretion system [BR:yph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPC_4024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: ADW00455
Position
3886723..3887214
Genome map
AA seq 163 aa AA seqDB search
MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLK
VCIIELNKEGWSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWA
IAAEFQEMSNGKSLLTLKSDARADFNRVVLVDGKALSLKASTK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcctctttcgtgtgttgcctatttttatcctgacaggttgcgtcctgctcagc
ggctgtagctggttttcctcatcctcagaagcggcgctacagaaacggcggattgacttg
caggttgttgcggctcctctcatcaatcctgggcccaacggtcaggcacagcccttgaag
gtatgcattattgagctgaataaagaggggtggtcaccccccggtttgtatcaggggacg
ctctgcagtggcatcagtgtaggaggtgaagtcgtcagcgtgacggaatacatccttgcg
ccgacagaggtgcgtcaatattcccgcgatgttccctttgaacaagagcgctggtgggca
atagcggctgagtttcaggagatgagtaacggtaaaagcctattaacgctgaaatctgat
gcccgtgcggacttcaaccgtgtggtgctcgttgatggtaaggccctgtcattaaaagcg
tcaacaaagtag

DBGET integrated database retrieval system