KEGG   Yersinia pestis Harbin 35 (biovar Medievalis): YPC_4417Help
Entry
YPC_4417          CDS       T01874                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
yph  Yersinia pestis Harbin 35 (biovar Medievalis)
Brite
KEGG Orthology (KO) [BR:yph00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yph02044]
    YPC_4417
Secretion system [BR:yph02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YPC_4417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N DUF3701
Motif
Other DBs
NCBI-ProteinID: ADW00812
Position
complement(4277410..4278192)
Genome map
AA seq 260 aa AA seqDB search
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDL
QTAVYYTLARTQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQL
RQHDFTRDDLRLVYRAERALQLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAK
AQQAAAPLKMPPMVYLSVPEAEPVRTAAAAPEPAANIEVRSPPRRLNGGRCCGALVPVSC
VVYWWRLRFTLPSSNRCNSK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaccccgcaacatatcatcattaaaaccggcactgacccacggaaccggccg
gaatttaacgccattcgtgaagagatcaacaaaatcaaccacccggcacggccagaggtc
aactggggtttgattgaatcactggcgctgaccctgttccgcacccacggcgtggatttg
cagacggcggtgtattacacgctggcccgcacccaaaaaaatggcctggccggtttcacc
gagggctgcgagttgctggccggtatggtagtcggccagtgggatcacctgtggccggaa
cagccgcaggcacgcagtgaaatactggaatggttcaatacccgcgtcagcaatcaactg
cgtcagcatgattttacccgtgacgatctgcggctggtgtaccgcgccgagcgggccttg
cagttgctgtacgataaattgcaacaggttgaattaaaacgggtaccgcgcattgaaaac
ttgctgtacctgatgcagaacaccgccaaaaaactcgaatcggccagtgatgcggcgaag
gctcagcaagccgcggccccgctgaaaatgccgcctatggtctatctctcggtacccgag
gccgagcctgtccggacggcagcggcagcccctgagcctgcggccaatattgaggtgcgt
tcgcccccccggcgactaaacggggggcggtgctgtggggctttggtgccggtgtcctgt
gtagtttactggtggcgactgcggtttacgttacccagttcaaaccgctgcaacagcaaa
tga

DBGET integrated database retrieval system