KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0115
Entry
YpsIP31758_0115   CDS       T00570                                 
Symbol
cytR
Name
(GenBank) transcriptional repressor CytR
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypi03000]
    YpsIP31758_0115 (cytR)
Transcription factors [BR:ypi03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    YpsIP31758_0115 (cytR)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_Tnp_ISL3 HTH_Crp_2 TetR_N HTH_3 DUF3606 HTH_24 TrmB
Other DBs
NCBI-ProteinID: ABS47689
UniProt: A0A0U1QYA7
Position
complement(121114..122142)
AA seq 342 aa
MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVEQAVLAVGYSPHALSR
NIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGDCAQQTQQERTFVNLII
TKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPTVHIDNLTAAYEAVNYLH
ELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVDNDYIIRGDFSYEAGAQSFAALM
ELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFDDLKLSQFCDPPLTTVAQPR
YQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIRESTAAPKH
NT seq 1029 nt   +upstreamnt  +downstreamnt
ttggaaaataagaaagaattcacaatgaccacgatgaaagatgttgctgaaatggcaggt
gtatcaacagcaaccgtgtctcgcgcgttgatgaaccctgaaaaggtttcaaccgtgacc
cgacaaaaagtggaacaagccgttttggctgttggttattctcctcatgctttatcccgt
aatattaagcgtaatgaatcacgtacgattctggtgatcgtacccgatatcagtgaccca
ttttttgccgatgtcattcagggcattgaacacgcagccgcccagcaaggctatctgata
ttaattggtgattgcgcacaacaaacccagcaagagcgcacatttgttaatctgattatc
accaaacagatcgatggcatgctgctattaggctctaacctgccttttgatgccagtaaa
gaagagcagcgaaatttacccccgatggtcatggcgaatgagtttgctcctgagttggag
ctgccgaccgtacatatcgataacctgaccgccgcttatgaagccgttaactatttgcat
gagttgggccataaacgcatcgcctgtatcgccgggccagaaagcctgccgctgagccat
tatcggttacaaggttatattcaggcactgcgtcgtaatggtattactgtcgataatgac
tatattatacgcggggatttcagctacgaagcgggggcccaaagctttgcggctcttatg
gagctgccccacccccccactgcaatattttctcacaatgatgtcatggcagtaggggct
atctggcaggcgaagcaattagggttacgcatcccgcaggatgtctcgctggttggcttt
gacgacttgaagctgtcacagttttgtgaccccccattaactaccgtcgcacaaccccgt
taccagattggccagcaagccatgttactcttactggagcaactgcaagggcattcagta
caaagtggctcccgcttgttagataccgaattaatcatcagggaaagtactgctgcgcct
aaacactag

DBGET integrated database retrieval system