KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0316
Entry
YpsIP31758_0316   CDS       T00570                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypi02044]
    YpsIP31758_0316
Secretion system [BR:ypi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpsIP31758_0316
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABS46150
UniProt: A0A0U1QUM6
Position
365436..367256
AA seq 606 aa
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKID
DQFPELTHGLLNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQR
SAFINSNAHAGPQCTFTLCRDVWLFPMSIREISANSSNEQGILSVHFAAKAELNLQDLQL
DKLRFYLGEDNYTSTQLYFWINHYFERAELVVNGITIPMPDFDFNPVGFERDDALLPYPK
NAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFSLNLYFSQALPPDVKVRSTTL
RMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSWLSEKGAPKGR
GRGHGRVYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAE
ENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLS
NMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPV
RGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYASVNAFHLLKVINLDNQECYEWPVQT
GQHALM
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtcgttcgaaaagtatttcagggacgagctggactacctccggcaattaggacgcgat
gccgcaatagaacggcctcatctcgctgcatttttatctgagcaaggttctgatccggat
gttgaacgtttgctggaaggctttgcttttctaacgggcaacctgcgtgaaaaaatcgat
gatcaattccctgaattgactcatggtttactgaatatgttgtggccgaactacttacgg
ccaataccgagcatgaccatcatcgagtacacaccggatgaaagtgtggtcaccgaggcg
acgctggtgaaacggggtagccaagtgatgagtatccccatcgcacaaaatggtcagcgc
agcgcgtttatcaacagtaatgctcatgccgggccacaatgtacttttacgttgtgccgt
gatgtgtggttgttccccatgtccatccgggagatctcggcgaacagcagtaacgaacaa
ggcattttgagtgttcactttgccgccaaagcggaattgaacttacaagacctgcaactg
gataaattgcgcttttatctgggcgaagacaactacaccagcacgcaactctatttctgg
attaaccactatttcgaacgcgctgaactggttgtcaacgggataaccatcccgatgcct
gattttgactttaacccagtgggctttgagcgcgatgatgccctcttgccgtacccgaaa
aacgcctatatgggttaccggatcctgcaagagtatttttgcttccctgaaggctttttg
ttctttgatgtcaatggtgtggtcgattttccgccgcacttgaatgccagtgaattctct
ctgaatttgtatttctctcaggcattgccgccggacgtgaaagtccgctccaccacactg
cggatgaattgcacacctgcggtgaacctgttccaacatgacagtgaagcgattgatctt
gatggaacccagacggaatacccgctctgtgtcagctaccataatccggatcactacgac
atcttttcagttgatcgggttgacagttggctcagtgaaaaaggtgctcctaaggggcgc
ggccgggggcatggcagggtgtacacctcgtttgagagcttccaccatcagatcgaacac
tcgcaagaaaagaccgcactttattaccgcctacgtgtgaaaaattcattattccgtaag
ggattcgaacactacatttcctttgttcgcagtgatgaatcgaagctggtgcttgctgaa
gagaatgtctcggtcagcctgacgtgcaccaaccgtgagttgccgctgtcgttgcgcgtt
ggtgatatcaatcaactcagcacagacagcccttcattcgcgacgttccgcaatattacc
cgtccttccgtgccgttgtatccggtgctggatgggggcctgcattggtcattgctctcc
aatatgtcgttgaactacatgtccttactggataaggacgcgttgaagcaaattctgcat
acctatgatttcccaagcctgcataaccggcaatctgccagggcatcgcaaaagaaactg
gacgctatccaacgtattgaaacacaaccgattgaccggttgtttcgtggcttacctgtc
agagggctacaaaccacgctatggctggagcaaggggcctttagctctgaaggcgagctt
tatctcttcagcacggtattagctcgcttcttctcactgtatgccagcgtcaatgcgttt
catcttttaaaagtcatcaatcttgataatcaggaatgttacgaatggccggtacagaca
ggtcaacatgcactgatgtaa

DBGET integrated database retrieval system