KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0319Help
Entry
YpsIP31758_0319   CDS       T00570                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YpsIP31758_0319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypi02044]
    YpsIP31758_0319
Secretion system [BR:ypi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpsIP31758_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: ABS47321
UniProt: A0A0U1QXF1
Position
369750..370295
Genome map
AA seq 181 aa AA seqDB search
MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQAADQPSTVRLTLLSD
RDTNPNEKGEAAPTEIVVVYLSENSKLLAADYDQLSSDALEKTLGKNYIDHQEYTLLPDQ
FKALDPIKLEEKNSYLGVIAHYADANRSEWKKIIKIKGIGHNYQVLVHVRSNDVDLRKEE
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgccagaggctatctcctgacgtgggcattatgtgtagtgttcctattgtct
gggtgcagcggtgcatgggaagccactaaaaaggtcggcaaggtggttatggaccccgat
attccggtggggcaggctgctgatcaaccctcaacggtcaggctaacattgctgtccgat
cgcgataccaaccctaatgaaaaaggggaagcggccccgactgagatagtggtggtgtac
ctaagtgaaaactccaagctgctggccgcggattatgatcagctaagcagtgacgcgctg
gagaaaacgctgggtaagaattacatcgatcatcaggaatacaccttactgcccgatcaa
ttcaaggcgctggaccctatcaagctggaagagaaaaacagctatctgggggtgattgct
cactatgccgatgccaaccgcagtgaatggaagaagatcatcaaaataaaagggatcggc
cataactaccaggttttggtccatgtcagatcaaacgatgtcgatctaaggaaagaggaa
gaataa

DBGET integrated database retrieval system