KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0728Help
Entry
YpsIP31758_0728   CDS       T00570                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypi02044]
    YpsIP31758_0728
Secretion system [BR:ypi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpsIP31758_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ABS49416
UniProt: A0A0U1R2D2
Position
889748..891100
Genome map
AA seq 450 aa AA seqDB search
MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVLQAVFEPDALAQGRLK
AARLHVRFPDGVLVDTECADVLPPTLTLAASLPAEASDATVMLAIPQLYANGGNCLQPDE
RGERPVRHRQAWRDVQNQFGDDKKQVAVMHHQLTLRLDTQENGDYQVCPVARLLRDAQGR
WTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMRRESNARMADFAVADVSLF
WLLNALNSAEPVLGNFQRYPQIHPERLYQELARLAGSLLTFSLEHEVTAIPVYQHEQLTR
VFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADFYLSVRSSLPA
AQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaacgccctctgtgggctcgcgggatcctggtgtctccgcaacaatttcaa
caacaggcttcctgggaggcctggaccaatgaatgcattgcgcaaatggccgtgatgcat
ccctggggcgtgcttcaggctgttttcgagccggatgcgctggcacagggccgcctgaaa
gcggcgcgtctgcatgtgcgttttccggacggtgtgctggtggataccgagtgtgctgat
gtgctgccgcccacgctgacgctggcagccagtctgcccgccgaggccagcgacgccacg
gtgatgctggcgataccacaactgtatgccaatggcggtaactgcctgcagccggatgag
cggggcgaacgcccggtacgccatcgtcaggcctggcgcgatgtccaaaatcagttcggc
gatgacaaaaagcaggtcgcggtgatgcaccaccaactgaccctgcggctggacactcag
gaaaacggcgattatcaggtctgcccggtggcgcgcttgctgcgggatgcgcaaggtcgc
tggacactggatccgggctttattccgccgatgctgagcctgcaggccagtgcctggtgt
ggcgaacagcttgagttattgatggtgcaactgcgggcgcgtttgcagcgtctgatgggg
atgcgccgggagagcaatgcacggatggccgattttgctgttgcggatgtgtcgctgttc
tggctgctcaatgcccttaacagtgccgaaccggtattggggaattttcagcgctatccg
cagatccacccggaacggctgtatcaggaactggccaggctggcgggcagcctgctgacg
ttctcccttgagcacgaagtgacggcgatcccggtttatcagcatgaacaactgacccgc
gtctttcccccgttgtttgccctgctgaatattctgctggaagccagcctcccttcacgg
gtagtggcgattgagctggttcatgaaccgcgtatcaatcagtggcgcgcgaccctgcgt
gaccctcgtctgcgcgaaggggccgatttctacctgtcggtccgttcctcgttgcccgcg
gcccaattgcagactcagttcccgcagttgtgtaaagccggtgcgccagatgaggtcggt
aacgtggtgaatgttgcgctgagtggcatcccactgcgtccactcagccatgtccctgcc
gccatccccttgcggctggaaaaccagtacttctcccttgatctcagccaccctgcggcg
acgcagatgatggagacgggggcctgtgtgttctatgtacccggtacgctgggtgagatc
caactggagctgtttgcggtgctacgcgcatga

DBGET integrated database retrieval system