KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0785
Entry
YpsIP31758_0785   CDS       T00570                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YpsIP31758_0785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypi02044]
    YpsIP31758_0785
Secretion system [BR:ypi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpsIP31758_0785
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 CENP-F_leu_zip Adhesin_P1_N
Other DBs
NCBI-ProteinID: ABS46495
UniProt: A0A0U1QVG9
Position
942531..945029
AA seq 832 aa
MNTSLPAIRFDHSHHKLVVRDSTAPVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATML
MQDASLTLAAPVAEAFGVTVQQTQRVIHGVVTGFKRLSASKDECRYELSLQPRLALLSRS
HQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFISRLLA
EVGLWFRFTADPKLNIDVVEFYDDQRFYPPGLTLQAVPPSGMHDSGVESVWDLSSAHQVV
EKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYADNYLIAGSEEREPESESGAFY
ARLRHERYLNNQARFSGVANAATLGPGQELKVTGSDVPAQFGKGVIITRITSYARRDRSY
EVHFEAIPYSEEYCFRPALIRKPTMAGTLPARVTSTTANDTYGHIDKDGRYRVNLMFDRD
SWEPGYESLWVRQARPYAGDTYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDH
VTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFE
LRTDSFGALRAEKGLFISADGQAKAQGQVLEMQPAISLLQGAQEQMDAISADAQTATASP
ADLQAQISLLQQNLSELKQAVVLLSAPKGIALSSGEHLQMSASENLIATAGKNTDISVAK
NFFIGVGNTLSIFVRKLGMKLIANQGPITVQAQNDLMELLARKAITITSTEDEIKITAKK
KITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKAKQVVAMPEFQLIPGGKHNLQF
LFTDDDNVPYSNTPYIAYLVDGREIKGVTDAKGNTEKFVTDEEQNIKINLQV
NT seq 2499 nt   +upstreamnt  +downstreamnt
atgaatacctctctccctgctattcggtttgaccatagccaccacaaactggtggtccgc
gacagcacggctcccgtcgatgtgctgggttttgaaggccacgaaagcttaagtcagccg
ttctgttacgacattcaatttaccagcgcagacaaggcgattgacccggccacgatgctg
atgcaggacgcgtcactgacattggcggccccggtggccgaagcctttggcgtgacggtt
cagcagacccagcgggtgatccacggcgtggtgaccggatttaaacgcctgtctgcttca
aaagatgaatgccgttacgaactgagcctgcaaccgcgtttggctttgttgtcgcgtagc
catcagaacgggatttatcaggacatgtcggtgccgcagattgtggaaaaaattctgcgt
gagcgccatgacatgcgcggtcaggattttgtcttcacgctggcccgcgagtacccccgc
cgtgagcaggtgatgcagtacggcgaagatgacctgacctttatcagccgcctgctggcg
gaagtggggctctggtttcgttttaccgctgaccccaaactcaatattgatgtggtggag
ttttacgacgaccaacgtttttacccgccagggctgacgctacaagcggtgccaccttcg
gggatgcacgacagcggcgtggagtcggtctgggacttgtccagtgctcatcaggtggtt
gaaaaatcggtcagtaccggcgattacaactaccgcaccgccactgccgatatgacggcc
ggggcagacatcactcgcggtgataccaccacctacggcgaagcttatcattacgccgat
aactacctgatcgcaggcagcgaagagcgtgagccggaaagtgaaagtggggcgttttat
gcccgcctgcgccatgaacgttacctcaataatcaggcgcgtttttcgggggtggccaat
gcggcgacactggggccgggtcaggagctgaaagtcaccggaagcgatgtgccggcacag
tttggtaaaggggtgataatcacccgcatcaccagctatgcccgccgtgaccgcagctat
gaagtgcattttgaggccatcccttactccgaagagtattgcttccgtccagcgcttatc
cgtaagccgaccatggccggaaccttgccggcgcgggtgaccagcaccactgcgaacgac
acttatggtcatatcgacaaagacgggcgctaccgtgtcaacctgatgttcgaccgtgac
agttgggagccgggttacgaaagcctttgggttcgtcaggcccgcccgtatgcgggtgac
acctacggcctgcacctgccgctgctggcgggcaccgaagtggcgattgcgtttgaagat
ggcaatccggaccggccgtatattgcctctgtgttgcacgactcggcgcacggcgaccat
gtcaccatcagtaattacaaacgtaacgtactgcgtactccgtcgaataacaaactgcgc
cttgaagatgaacggggtaaagagcacatcaagctcagcaccgaatacggcggcaaaagc
caactgaatctggggcatttggttgataacgagaaacaaccacggggtgaaggttttgag
ctgcgtaccgacagttttggtgcattgcgtgcagaaaagggcctctttatcagtgccgac
ggtcaggccaaagcccaggggcaggtgctggagatgcaaccggctattagcctgttgcaa
ggtgctcaggaacagatggatgccatctccgcggatgcacaaaccgccaccgccagtccg
gccgacctgcaggcacaaatcagtttgttgcagcaaaatctgagtgagctgaaacaagcc
gtggtattgctgagtgcgccaaaaggcattgccttgagcagtggtgagcatctgcaaatg
tccgccagcgaaaatctgatagccactgccggtaagaataccgacatcagcgtagcaaag
aacttctttattggtgtgggaaataccttaagtatcttcgtcagaaaactggggatgaag
ttgatagccaatcagggtccaataacggtacaggcgcaaaatgacctgatggagttattg
gcgcgcaaagcgataacgatcaccagtaccgaggatgagataaaaatcaccgccaagaag
aagataacgctaaatgcaggcggcagttatatcacgctggatgagaaccggatcgagtca
ggaacggcgggggaatatctgaccaaggcagggtattacgggcgacaggaaaaagcgaag
caggtagtggcaatgccagaatttcagctgattcccggtgggaagcataatctacaattt
ctatttaccgatgatgataatgtaccttattcaaatacaccgtatattgcttatcttgtc
gatggaagagaaattaaaggagtgacagatgcaaaaggtaatacggaaaaatttgttacc
gatgaagagcaaaatataaaaataaatttacaggtatag

DBGET integrated database retrieval system