KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0796
Entry
YpsIP31758_0796   CDS       T00570                                 

Definition
(GenBank) ImpA domain protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypi02044]
    YpsIP31758_0796
Secretion system [BR:ypi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpsIP31758_0796
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: ABS48135
UniProt: A0A0U1QZC4
Position
958005..959609
AA seq 534 aa
MATLNTLITACAAVPDSLLLKAEQQVTLWDRWLQPVTTEQHSGEDLSYNDDFQQMREEVN
KLSGADTTLASELAEKLLTLHGKDVRVATYYIWARLHRDGEAGLADGLALLAGLISRFGE
TLHPLRAASRKTALEWLSSSRVLDSLSLYPEVDNADFERIVGALALIEQSLSGWDDASRP
QFGGLYLALEHRLAQSGGPNAVVPQNSSGSSSAGSQGQTAMVSPELRPVQSGRDLLDQAK
TLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVSGRTRLVPPRPEYRVLLKRLYLQQ
NWLELLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWAACITQDLRLLLTRLPGL
EGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVMASGEDDILLLEPEALAQADSE
GIEAALNWLQSRPGITTARHQWLLRLVMARVAEQYGKNDMALHLLSELDSRGALLTLPQW
EPGLAFEVKARSLKLLRMKAQRSDSEKTRLHIEMESLLSGLMALDPARAAVLCG
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggcgacgttaaataccctgatcactgcctgtgccgctgtccctgattcactgttatta
aaggcagaacaacaggttacactttgggatcgctggttgcagccggtgacgactgaacag
cacagcggagaagacctcagttacaatgatgacttccagcagatgcgtgaagaggtcaat
aagctctcgggtgctgataccacgttagccagcgagctggcagaaaaactgttaaccctg
catggcaaagatgtgcgggtggcaacctattacatttgggcgcgtttacaccgtgatggc
gaggctgggctggcggatggactggcactgctggccgggcttatcagccgttttggtgaa
accctgcatccgttgcgcgcagccagtcggaaaactgcgctggaatggctatcgagttct
cgcgtgctggacagtttgtcgctctatcctgaagtggataatgcggattttgaacgcatc
gttggcgcactggcgttaatcgaacagagcctcagcggctgggatgacgcatcccgtccg
cagtttggtggattgtatcttgccttggaacatcgtctggcgcagtccggtggaccgaat
gcggtggtgccacaaaacagcagcgggtcatcatcggcagggagtcagggccagacggct
atggtttcaccggagttgcggccagtccagtcggggcgtgacctgctcgaccaggctaaa
acgttagcaaaatacctgcggaaccagccgcagggatggctctccgggcatcatcttatc
aagagcgtgcgctgggatacggtacaccagtcaccgccgttggatgtgagtggacgaacc
cgactggtaccgccgcgcccggaatatcgcgtgctgcttaagcgtctttatctgcaacaa
aactggctggagttgttggaacaggcggaatcgatatttgccgaaggggtcaaccatttc
tggctcgatgtgcagtggtatctgcatcaggcactcagtaaagcgggagccccattcgat
ggctgggcagcttgtatcacccaggatttacgtctgttactgacccggctgcccggtctg
gaggggctatgctggagtgacggcacgccgtttgccgatgaggtgacgctggggtggata
aaccagcaggtgctggagtcggtgtcgggctggggcagcgagcctgccgccgtgatggca
tcgggcgaagatgacattctgttgctggagccagaagctctggctcaggcggacagtgaa
gggattgaagccgcacttaactggttgcaatcccgtccgggtattaccactgcccgccat
cagtggctgctgcgtttggtgatggcccgcgtggcggagcagtacggcaagaacgatatg
gcactgcatctgcttagtgaacttgatagccgcggtgcattgctaaccttgccgcagtgg
gagccggggctggcgtttgaagtcaaagcccgaagtctgaagctgctgcggatgaaagca
caacgcagcgacagtgaaaaaacccgcctgcatatcgaaatggaaagcttgctcagtggg
cttatggccctcgacccggcccgtgcggccgtattatgcggataa

DBGET integrated database retrieval system