KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0797Help
Entry
YpsIP31758_0797   CDS       T00570                                 

Definition
(GenBank) PAAR domain protein
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ntox44 PAAR_motif
Motif
Other DBs
NCBI-ProteinID: ABS47115
UniProt: A0A0U1QWX6
Position
959627..960685
Genome map
AA seq 352 aa AA seqDB search
MAKGYYLGVGDQTTCGGVIIEGDATHILMGKAVAREQDRVTCGKHPGTYIIVGHIPGDSI
HGRKFAGTLNSQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESE
EKSKVVCAHIDGALVVASYILDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYAR
MNAPPQPEIISASVLWFMAVKSGAKWDHKPKIRDQFKAYAVSRPLVGSGTRSKSYFHKYE
EHDYFYDVWSNIHYGYVGLSLGFDESYLLLGSTLEQVRTSIGSKPDPIDDITCMKIGYAL
YHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNNDNSSQIDHPQGK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggttattaccttggtgttggggatcaaacaacctgtggtggcgtgatcatc
gaaggtgatgccactcatatcctgatgggcaaagccgtggcccgtgagcaagatagagta
acctgcggcaagcatccgggaacttatatcattgtcggccacattcccggtgattctatt
catggccgtaagtttgctggcaccttgaatagtcaaagcaattgcccgtgcaaggcgtgg
tttattccttctttggtgcatgatacgtatgagtttggtgcaagaagtaaatcacaaaat
atgtctgaaattagtactgaagtcgaacgtgagatggtagaaaatgtgagtgaatcagaa
gaaaaatctaaagttgtctgtgcccatattgatggcgctttagtagtagcgagttatatc
cttgatgaaataaagaaaaatgtaaaaagtgataccgctgataaaatcagatcttttatc
gataatgacctctataaaaaaagacttaaggagtggcaggattctccttggtacgcgaga
atgaatgcacctccacagcctgaaataatatcggcatcggttttatggtttatggcggtc
aagagtggtgctaaatgggatcataaacctaaaattagagatcaatttaaagcatatgca
gtttctcgtcctctggtcggaagcggaacccgatcaaaaagctattttcataaatatgaa
gaacatgattatttttatgatgtctggtccaatattcactatggttatgtaggcttaagt
cttggttttgatgagtcatatttattacttggctcaactcttgagcaagtaagaaccagc
atcgggagtaaaccagatcctatagatgatattacatgtatgaaaattggctatgcactc
tatcatcaacatggaaaatatgctgagacgttagatgtcaggcatatactcgatgctctt
gaatcagcatcggaccttgatctagctatttcaagacaaattcattggtgttggaataat
gataattcgagtcaaattgatcacccgcagggtaagtaa

DBGET integrated database retrieval system