KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_0883Help
Entry
YpsIP31758_0883   CDS       T00570                                 

Gene name
lysS
Definition
(GenBank) lysyl-tRNA synthetase
  KO
K04567  lysyl-tRNA synthetase, class II [EC:6.1.1.6]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00970  Aminoacyl-tRNA biosynthesis
Module
ypi_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YpsIP31758_0883 (lysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypi01007]
    YpsIP31758_0883 (lysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypi03016]
    YpsIP31758_0883 (lysS)
Enzymes [BR:ypi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.6  lysine---tRNA ligase
     YpsIP31758_0883 (lysS)
Amino acid related enzymes [BR:ypi01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   YpsIP31758_0883 (lysS)
Transfer RNA biogenesis [BR:ypi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YpsIP31758_0883 (lysS)
 Prokaryotic Type
   Other AARSs
    YpsIP31758_0883 (lysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: ABS46325
UniProt: A7FF39
Position
1066315..1067832
Genome map
AA seq 505 aa AA seqDB search
MSEQKPQVAEQAQELNSELQARREKLAVLRGKGIAFPNDFRRENLSDQLHAEFDSKENEE
LEALNIDVTVAGRMMTRRIMGKASFVTLQDVGGRIQLYVSRDDLPEGVYNEEFKKWDLGD
ILGARGKLFKTKTGELSIHCSELRLLTKALRPLPDKFHGLADQETRYRQRYLDLIANDES
RHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGASARPFVTHHNALDIDMYLRIAP
ELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIVLTEELFRT
LTETILGSSVVQYGEQTFDFGKPFAKLTMKEAICKYRPETNVADLDDMDKAVAIAESLGI
KVEKSWGLGRIQCEIFEETAESHLIQPTFITEYPAEVSPLARRNDDNPFITDRFEFFIGG
REIGNGFSELNDAEDQAQRFADQVSAKEAGDDEAMFYDEDYITALEHGLPPTAGLGIGID
RMVMLFTNSHTIRDVILFPAMRPVK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcaaaaaccacaagtcgctgagcaagcgcaagaactcaatagtgagttacaa
gcccgtcgagaaaaactggctgtcttacggggaaagggaattgcattccctaatgatttc
cgccgtgagaacctttccgaccagttgcatgccgagtttgacagtaaagagaatgaagag
ttagaagcactgaatatcgacgtaaccgttgctggccgtatgatgacccgccgtatcatg
ggtaaagcatcatttgtgactctgcaagatgttggtggccgtatccagttgtacgtttcc
cgtgatgacctaccggaaggcgtttataacgaagaattcaaaaagtgggacctgggcgat
atcttgggtgcgcgcggtaaactgtttaaaaccaaaaccggtgagctgtcgatccactgt
agcgaactgcgtctgttgaccaaggctctgcgtccattgccagataaattccatggctta
gctgaccaggaaacccgttaccgccagcgttatttggatctgattgctaacgacgagtct
cgtcatactttcaaagtccgttcgcaagtgatgtccggtatccgtagcttcatggttgaa
aaaggcttcatggaagtcgaaacgccaatgatgcaagtgatccctggcggcgcttccgca
cgtccgtttgtcacgcatcacaatgcgttggatatcgatatgtatttgcgtatcgcgcca
gagttgtatctgaaacgtctggtcgtggggggcttcgaacgtgtgttcgaaatcaaccgt
aacttccgcaacgaaggggtttcgccacgtcataacccagagttcaccatgatggaactc
tatatggcttatgcggactataaagacctgatcgtcttgacggaagagctattccgcact
ctgaccgaaaccatattggggagcagtgtggtgcaatatggcgaacagacttttgatttc
ggtaagccttttgccaaattgaccatgaaagaagctatttgtaaatatcgtcctgaaacc
aatgtcgcggatttagacgatatggataaagccgtcgcaattgccgaatcattgggtatc
aaggttgagaagagctggggcctgggtcgtattcaatgtgaaatctttgaagagaccgca
gaaagtcatcttatccagccaacgttcatcacagaatatccagccgaggtttctccgcta
gcacgccgtaatgacgataatccatttatcactgaccgctttgaattcttcatcggtggc
cgtgaaattggtaatggcttctctgagttgaacgatgccgaagaccaggcgcagcgtttc
gccgatcaggtaagtgctaaagaagctggcgatgatgaagcgatgttctacgatgaagac
tatatcactgcattggaacatggcttaccaccaaccgcagggctaggtattggtattgac
cgtatggttatgttgtttaccaatagccataccatccgtgatgtcattttattcccagcg
atgcgcccggtaaaataa

DBGET integrated database retrieval system