KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_1293Help
Entry
YpsIP31758_1293   CDS       T00570                                 

Definition
(GenBank) putative N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00520  Amino sugar and nucleotide sugar metabolism
ypi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YpsIP31758_1293
Enzymes [BR:ypi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     YpsIP31758_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ABS46631
UniProt: A0A0U1QVT5
Position
complement(1512418..1513311)
Genome map
AA seq 297 aa AA seqDB search
MKKLTGLIAAPHTPFDEQGEVNYPVIDQIAEHLINDGVKGVYVCGTTGEGIHCSVDERKK
IAERWVNAAQGKLSITLHTGALSIKDAVDLSRHAETLDIFATSAIGPCFFKPGNLDDLIA
YCQAIAAAAPSKGFYYYHSGMSGVNLDMEQFLIKAESKIPNLSGIKFNNADLYEFQRCLR
VSGGKFDIPFGVDEHLPGGLAVGAIGAVGSTYNYAAPLFHKIIADFNAGDQVAVQRGMDH
VIALIRVLVEFGGVAAGKAAMQLHGIDAGNPRLPLRALTKEQKQTVVNRMRDAITLQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttaaccggcctgatcgcagctccgcacactccctttgatgaacagggcgag
gtcaattatccggtcattgaccaaattgccgagcatctgatcaatgatggcgtgaaaggc
gtttatgtctgtggtaccactggcgaaggcattcattgctcagttgatgagcgcaagaaa
attgctgaacgctgggtaaacgccgctcaaggcaaactgagcattaccttacacaccggt
gctctcagtattaaagatgcggttgatctctctcgtcatgcggaaacactggatatcttc
gcaacctcagccatcggcccctgtttctttaaaccgggtaatctggatgacctcatcgct
tattgtcaggcaatagccgcggctgcaccgtcgaagggcttctattactaccactcaggt
atgtccggtgtaaatttggacatggaacagtttctgatcaaagcggaatccaagatccct
aacttgtcaggaattaaattcaataacgctgatttgtatgagtttcaacgctgtttacgt
gtgagtggcggtaaatttgatattccgtttggcgttgatgaacatctgccgggtggatta
gctgtaggggctattggcgctgttggcagcacttataactatgccgctccgctgttccat
aaaattatcgctgactttaatgcgggtgatcaggttgcggtacagcgtggaatggatcac
gttatcgccctgatccgtgtgctggtcgaattcggtggtgttgccgccggtaaggccgcg
atgcaattacatggtattgatgccggtaacccacgtctgccactgcgtgccttgaccaaa
gaacagaagcaaaccgtggttaacagaatgcgtgacgctattacgttgcagtaa

DBGET integrated database retrieval system