KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_1890
Entry
YpsIP31758_1890   CDS       T00570                                 

Definition
(GenBank) type I secretion membrane fusion protein, HlyD family protein
  KO
K12532  membrane fusion protein, RTX toxin transport system
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YpsIP31758_1890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypi02000]
    YpsIP31758_1890
   02044 Secretion system [BR:ypi02044]
    YpsIP31758_1890
Transporters [BR:ypi02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   YpsIP31758_1890
Secretion system [BR:ypi02044]
 Type I secretion system
  RTX toxin transporter
   YpsIP31758_1890
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 Biotin_lipoyl
Other DBs
NCBI-ProteinID: ABS46158
UniProt: A0A0U1QUN3
Position
complement(2192006..2193376)
AA seq 456 aa
MSAFIQHIKNRWTRCFTPARTRDEYDFLPAYLEIVERPIAPLARRTAWLLILTLLLVLIW
AIIGKLDIHASASGKVIVAEHSKIIQPAEPGVVTEINVRDGDTVDAGQVLIALNPIGIDA
EVRNINQQLQYRQLEAARLVALLADEPLKNFKPPYNSPESLVVASRALLTKEYAEVTAEL
SRQDSELAVNQAHLQAGIEHNSHQKALLKNIHRRLQASRTLAKSKSIAEVELLVQEREWL
TATAEANRLQSEQDILRAKAHSLAQTRMHYLAKIDRDNRERLNKTHEIIHQLQQEQIKMM
DKQRQQTLRAPVAGVIQQLAVHTLGGVVTTAQPLMVLVPEDYQLELDVMILNKDVGFVLP
GQAVEVKVDSFPYTRFGTLSGEVKHVSRDAMEDQQRGLVFPARIRLLSDTLMVEGKPVRL
SAGMAINAEIKTGRRRVIDYLLSPLQQYQSEAMRER
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgtctgcgtttattcagcacataaaaaaccgctggacgcgttgttttacccccgcgcgt
acccgtgatgaatatgattttttgcctgcttatttggaaattgtcgagcgcccgattgcc
ccattagcccgtcgtacagcgtggttactcatactgacattattgctggtattgatatgg
gcgattattggaaaacttgatatccatgcctcagccagcggcaaagtgattgttgcggaa
cattccaaaattatccaacccgcagaacctggagtggtgacggaaattaatgtccgagat
ggggataccgttgatgccgggcaggtgcttattgcattaaaccctattggcattgatgcc
gaagtacgcaatatcaatcagcaactacagtatcgtcagttagaagccgctcggttagtg
gctctcctggctgatgaaccgctaaaaaatttcaagccgccttataacagccctgaatct
ctggtggtggcatccagagcactgttaacaaaagaatatgccgaagtgacagctgaattg
tcacgtcaggatagcgaactggcggtgaatcaggcgcatcttcaggccggaattgagcac
aactctcatcaaaaagcattgctgaaaaatattcatcggcggctacaagcgtcgcgtacg
ctggctaaatctaagtcaattgccgaggtcgagcttctggtacaggagcgggaatggtta
acggcaacggctgaagccaaccgtttgcagagtgaacaagatattttacgggccaaagca
cacagtttggcgcaaacccgtatgcactatctggcgaaaatagaccgtgataatcgggag
cgattgaataaaacccacgaaattattcatcagcttcagcaagagcaaatcaaaatgatg
gataaacaacgccagcaaaccctaagagctccggtggctggcgttatccagcaattagcg
gttcataccttagggggggtggttaccacggcgcaaccgttaatggttctggttccggag
gattatcagttggaacttgatgtcatgatcctcaataaagatgtggggtttgtcctgcca
ggccaagcggtagaagtcaaagttgacagcttcccttatacccgcttcggtacgttatcc
ggggaagtaaaacatgtttcccgtgatgcaatggaagatcaacaacggggactggtattt
ccagcgcgtatccgtttactcagcgataccctgatggtggagggtaaaccggtgcggttg
tctgcggggatggccatcaatgcggaaattaaaacaggtcgccgtcgggtcattgattat
ctgctgagtccattgcagcaatatcaatctgaagccatgagggagcgctaa

DBGET integrated database retrieval system