KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3429
Entry
YpsIP31758_3429   CDS       T00570                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YpsIP31758_3429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypi02044]
    YpsIP31758_3429
Secretion system [BR:ypi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YpsIP31758_3429
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: ABS46470
UniProt: A0A0U1QVE9
Position
complement(3862044..3864392)
AA seq 782 aa
MQLIEIENEVLSGQDAFPLSFKTQEKVSGNPSYQLVFQVAEADLDLVSLLGEIIKVRIEL
PDSAGYRTFFTYVIAGADEGQRQDKFVYSLELSTWTWFLMQNRNCRIFQDLNIIDIIEQV
FSKYNFADYRFDIVGNYRLREYCVQFAETDFDFVNRLMEDEGVWYYFEHNEDKHTLVMTD
QQQFPVLEGHYAELSFLPDSEEMRAIREGIQRIQRSQRIHSSEIVLRDFDFLNPRNTLQT
HIEESRQHLQGVPLEWYDYAAGYTDPQHGESIARLRLEAIQSNGQLLSGESNATGLVPGR
SFALVQHPDNNRNRGFKLISCDYSFVQDGPDSASQGRNVACKFKALNDDVVYRPQCVTPP
PKVPGVQSATVVGARESEVHTDKFARIRVHFHWDRYKTTEDDSSCWIRVVQAWAGKGWGV
LAMPRVGQEVLVNYVDGDLDRPMVTGIVYNGENPPPYRLPDHINYSGFVSRSLRFGQPQH
ASQLTFDDNRGNERIMLHAERDLQRTVERNSATAVGQDKYDTVERTATEWINNHISYKDF
SFSVTGMSVSATGISVSTTGTSLSVTGMSTSVTGVSVGFTLIGTSFTGVSASFTGVSTSF
TGASNSLTGVSNSMTGCSSSFTGTSNSMTGSSHSMTGMSTSITGHSMSQTGSSSSITGDS
TSFTGSSVSSTGSSVSTTGVSTSTTGSSTSTTGCSVSTTGSSTSTTGNSVSMTGNSTSTT
GCSISTTGSSIGTVGSSISTTGSSVSTTGSSISTTGLSVSYTGAQYSDVGVDLKTVGMQS
KN
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgcaattaattgagatagagaatgaggttttatcgggccaggatgcttttcctctctcc
ttcaagacgcaggaaaaagtgtcagggaatccatcctaccaactggtatttcaggtagca
gaagcggacctcgatctggtcagtttgctgggggaaatcatcaaagtcaggattgagtta
cctgactcagccggctaccggaccttttttacctatgtgatcgccggtgctgatgaaggg
caacggcaagacaaatttgtttacagcctggaactgagtacctggacgtggtttttgatg
caaaaccgcaactgccggatatttcaggacctgaatattatcgatattatcgaacaggta
ttttccaaatataactttgcggattaccgttttgatattgtcggtaactatcggttacgc
gagtactgcgtacagtttgcagaaaccgatttcgactttgttaatcgtctgatggaagac
gaaggcgtttggtattacttcgaacataacgaagataagcacacgctggtcatgacagat
cagcaacaattccctgtattggaagggcattatgcagaactgagtttcctgcctgacagt
gaagagatgcgcgccatccgtgaggggatacagcgtattcaacgctcacaacgcatccac
tccagcgaaattgtcttacgtgacttcgatttccttaatccacgcaatacattacaaacc
catatcgaagaaagccgccaacacctgcaaggcgtaccactggaatggtatgactacgcg
gcgggttacaccgatccccagcatggtgagagcatcgcccgtttacgccttgaagctata
cagagtaatgggcagctcttgtctggtgaaagtaatgccacaggattagtgccagggcgc
tcttttgctctggtacagcaccctgataacaaccgtaatcggggattcaaactgatcagt
tgtgactacagttttgtccaggatgggccggacagtgcgagccagggacgtaatgtcgcc
tgtaagtttaaggcattgaatgatgacgtcgtttatcgtccacaatgtgtcacgccaccg
ccaaaggtccctggtgtgcaaagtgccacagtggtcggtgcgcgtgaatcagaagtgcat
accgataagttcgcccgtattcgcgttcactttcactgggatcgttataaaaccaccgaa
gatgatagctcctgctggatccgcgttgtacaggcgtgggccggtaaaggctggggcgtc
ctggcgatgcctcgggtcgggcaagaagtgctggtcaattacgttgacggcgatcttgat
cgcccgatggtgaccgggatcgtctacaacggtgagaacccaccgccttaccgtttacct
gaccacattaactactccggttttgtctcacgctcactgcgctttggtcagccacaacac
gccagccagcttaccttcgatgataatcggggcaatgagcggatcatgctacatgctgag
cgcgacttacaaagaacggttgaacgtaacagtgcgacggccgtcggtcaggataaatac
gacacggtggaacggacggccacggagtggatcaacaaccatatctcctacaaagacttc
agtttctcggtgactggcatgagtgtctccgcgacgggcatcagtgtctcgacaacggga
acgagcttatctgtcaccggcatgagcaccagcgttacgggtgtcagtgtcggtttcacc
ttgatagggacctcttttactggcgtgagcgcgtcgtttactggtgtcagtacctctttc
accggggccagcaactcgctaaccggtgtcagcaactcgatgaccgggtgtagttcctcc
tttaccggtactagcaatagcatgacaggcagtagccatagcatgaccggcatgagcacc
agcatcaccgggcatagcatgagtcagacgggttccagtagcagcatcaccggtgacagt
acctcctttaccggcagcagcgtcagcagtacgggcagcagcgtcagtacgaccggtgtt
agcaccagcactacggggagtagcacctcgactaccggttgtagcgtcagtactacgggt
agcagcacctcgactaccggtaattcagtcagcatgaccggtaacagcaccagtaccacg
ggatgcagtatttccacgacgggcagcagtattgggacggtaggaagcagtatcagcacc
acgggcagtagcgtcagtaccaccggtagcagtatcagcaccacgggattatccgtcagt
tataccggcgctcaatattccgatgtgggtgtcgatctgaaaaccgttggcatgcaaagc
aaaaactga

DBGET integrated database retrieval system