KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3474Help
Entry
YpsIP31758_3474   CDS       T00570                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00260  Glycine, serine and threonine metabolism
ypi00750  Vitamin B6 metabolism
ypi01100  Metabolic pathways
ypi01110  Biosynthesis of secondary metabolites
ypi01120  Microbial metabolism in diverse environments
ypi01230  Biosynthesis of amino acids
Module
ypi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YpsIP31758_3474 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YpsIP31758_3474 (thrC)
Enzymes [BR:ypi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YpsIP31758_3474 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABS49736
UniProt: A0A0U1R343
Position
complement(3917446..3918735)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQALVKQAFDDEELKTALSLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDKTTKDTMRELAGLGYISEPHAAIAYRV
LRDQLQDGEFGLFIGTAHPAKFKESVEAILGQELPLPKPLAVRAQLPLLSHDLSADFAQM
RAFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcataacgagcaggtcagcttcgcacaggcgatcaaa
caaggcttgggcaaacagcaggggctatttttcccgttggagttgcccgagttcgaactg
actgagatcgataaactgctggatctggattttgtgacccgcagtagccgcattctgtcg
gcttttattggtagcgaaatcgcaccagatgtcttaaccaaacgtgtgcaggcagctttt
gaattcccagcccctgttgcacaagttgaaaatgatatcgccgttctggagttgttccac
ggcccgaccttggcgtttaaagactttggcgcacgttttatggcacagatgctggccgaa
gttgctggcgatcaacccgtcactattttaacggcaacatcgggtgatactggtgcggcg
gtggctcatgcattctacgggctgaaaaatgttcgagtggttatcctttatccacgaggc
aagattagtccgctgcaagaaaagctgttttgtactctgggcggtaatattcacacggtg
gcgattgatggcgattttgatgcttgtcaggcactggttaagcaagcttttgatgatgaa
gaactgaaaaccgcgctgagtttgaattccgctaactcaattaatatcagccggttactg
gcacaaatttgttactactttgaagctgtagcccagttgccacaagaggcgcgcaaccaa
ctggttatctctgtaccaagcggtaactttggtgatttgactgccggtttgttggcaaaa
tctttagggctaccggtgaaacgctttattgctgccactaatgctaacgacaccgtgcca
cgctttttggttaacggccagtggcagccaaagccaactgtagccacgttatcgaatgcc
atggatgtcagtcagccaaataattggccacgtgtggaagagctatatcgtcgcaaaatc
tggcagttgaaggatttagggcatggtgcggttagcgataaaaccacaaaagatacgatg
cgtgaattagctggtttggggtatatctctgagcctcacgcggcgattgcttaccgtgta
ttgcgtgatcagttgcaagatggtgaatttggcttgtttatcggaaccgcacatcccgcg
aaattcaaagagagcgtagaggcaattctgggtcaggaattacctttaccaaaaccactg
gccgtgagagcgcaattaccgttgctatcccatgatttgtccgcagactttgcacaaatg
cgggcatttttgatggcattgccgaagtaa

DBGET integrated database retrieval system