KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3497Help
Entry
YpsIP31758_3497   CDS       T00570                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00240  Pyrimidine metabolism
ypi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YpsIP31758_3497 (deoA)
Enzymes [BR:ypi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YpsIP31758_3497 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABS45942
UniProt: A7FMH4
Position
complement(3946043..3947365)
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQPLSEEEIRFFINGIRDNVVSEGQIAALAMTIYFHDMSMPERVALT
MAMRDSGTVLNWKSLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNAFRKIIQNVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYSLSADLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNGVEVREAVRFLTGEYRNPRLLEVTMALCVEMLLSGGLAHDEADARAKL
QAVLDNGKAAEVFGRMVAAQKGPVDFVERYDSYLPVATLSKPVFAEQTGIITAMDTRALG
MAVVALGGGRRRATDPIDYSVGLTEMARLGTRVDGQQPLAVIHANNEDDWQQAAEAVRAA
ITLGNNAPEETPVIYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctggcacaagaaattatccgtaaaaaacgcgacggtcagccattgagcgaagaa
gagattcgtttttttatcaatgggatccgcgataacgttgtttctgaagggcaaattgcc
gctttagcgatgaccatttatttccacgatatgagtatgcctgagcgcgttgcgctgacc
atggcgatgcgtgattccggtactgtgctgaattggaagagcctgaatctgaatggcccg
ctggtcgataagcactccactggtggcgtgggtgatgtgacgtcactgatgcttggcccg
atggtggcagcttgcggcggctatgtgccgatgatctctggccgtggtcttggtcatacc
ggcggcacactggataaactggaggcgatccccggttttgatattttcccggatgataat
gcgttccgcaaaattattcagaatgttggtgtggcgattatcggccaaaccagctcgctg
gcccctgccgataagcgtttttacgcgacccgcgatattacggcaacagtagattctatt
ccattgattacggcctctatcctggccaaaaaattggcggaaggcctggatgcattggtc
atggacgtgaaggtcggctctggtgcctttatgccaacctactcgttgtcggctgatttg
gcgcaggcgattgttggtgtggcaaacggggcgggttgcaaaaccacggcgctcctgacg
gacatgaaccaagtcctggcatccagcgccggtaatggggtcgaagtccgcgaagctgtg
cgtttcctgacgggcgaatatcgcaacccacgtttgctggaagtgactatggcgctgtgt
gttgaaatgttgctgtcaggcggtttagcgcacgatgaagccgatgcccgtgccaagctg
caagccgttttggataacggcaaagcggcagaagtctttggccgcatggtggccgcgcaa
aaaggcccggtagactttgttgaacgctatgacagctacctgcccgttgctaccctaagc
aaaccggtatttgctgaacagacgggaatcattactgcaatggatacccgcgccttgggt
atggcggtggtcgccctcggcgggggacgccgtcgggcaacggatcccattgattatagt
gtagggctgacggaaatggcccgcttgggtacccgtgttgacgggcagcagccacttgcg
gtgatccatgccaataacgaagatgactggcaacaggcggcagaggctgtgcgtgcggcc
atcaccttagggaataacgcgccagaagaaacgccagtgatttatcgccgtatcactgaa
taa

DBGET integrated database retrieval system