KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3698
Entry
YpsIP31758_3698   CDS       T00570                                 

Definition
(GenBank) conserved domain protein
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
SSDB
Motif
Pfam: SBP_bac_3 DUF3742
Other DBs
NCBI-ProteinID: ABS48871
UniProt: A0A0U1R129
Position
4172940..4173236
AA seq 98 aa
MSSQGFDPKDLEEICARKPHKYKMNKADYQELGKNLLLGSVDIAVGSVSAAALTASVFMT
DETDQSPSQQKNGWCHGSQGWGNYVNGEKLHYDEDDLS
NT seq 297 nt   +upstreamnt  +downstreamnt
atgagctcacaaggttttgatccaaaggacttggaagaaatttgcgccagaaagccccat
aaatacaagatgaacaaggctgattaccaagagcttggaaaaaatctgctacttggttcc
gtagatattgccgtcggaagtgtgtctgccgccgcgttaacagcatctgtgtttatgaca
gatgaaactgatcaatcacctagccagcagaaaaatggttggtgtcatggctctcaaggc
tggggtaactacgtaaatggcgagaaacttcattatgatgaagacgatttgagctga

DBGET integrated database retrieval system