KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3706
Entry
YpsIP31758_3706   CDS       T00570                                 

Definition
(GenBank) putative lipoprotein
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-ProteinID: ABS49340
UniProt: A0A0U1R268
Position
complement(4185306..4185707)
AA seq 133 aa
MKKTIKFASIPLLFAVVTLAGCSTSKDQMLPPGGSTMLTLWNDSSSATHATREGRTTLRR
TLMEPLDLVTETGSRIQENEIQDRFPRLPNPDLVMFVYPHFAGSHTPVPGYSTVFPFYSQ
VQYALPGERTVEL
NT seq 402 nt   +upstreamnt  +downstreamnt
atgaaaaaaacaatcaagttcgcttctatcccacttctttttgctgtcgtgacgttggcg
ggttgcagtaccagtaaagatcaaatgttaccgccgggcggcagcaccatgctgacactg
tggaacgatagttcatcagccactcatgcaacccgtgaagggcggacaacgttgcgccgc
actctgatggagccgttggatctggtgactgaaactggcagccgcatccaagaaaatgag
atacaggacaggttcccacggctgcctaatcccgatttggtgatgtttgtttatcctcac
ttcgcgggcagtcatacgccggtgccgggttatagcaccgtatttccattctatagccag
gttcagtatgcccttccgggtgaacgcacggtggaattgtga

DBGET integrated database retrieval system