KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3720
Entry
YpsIP31758_3720   CDS       T00570                                 

Definition
(GenBank) transglycosylase SLT domain protein
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: ABS46853
UniProt: A0A0U1QWB1
Position
complement(4198186..4198824)
AA seq 212 aa
MANRSILTAIFLMLFILGNGLPASAKTHPTLQTIPSIYREIAAEARVPAAFLYSLALVES
SRRFKGGERPWPWTINVAGKGYRYETREEAWHALLRFVRQAPLKRIDVGIAQVNLGWNGH
LFPSFYDVFDPNTNLRVAAQILRACYENRAGSWINAAGCYHHPAGGKPAANYIAIVRRKL
DTLAPVHIAVSSKTTISDVTSVNHPLIWIEPK
NT seq 639 nt   +upstreamnt  +downstreamnt
atggctaatcgcagcattctgaccgcaatcttcctgatgttgtttatattgggcaacggc
ttgccagcatcagccaaaactcatcccacattgcagacaatcccctcgatctatagggaa
atcgccgctgaagcccgagtaccagcggcgtttctatactcgctggcgctggttgaaagt
tcacggcgctttaagggcggagagcgtccgtggccatggacgattaatgtggcaggcaaa
gggtatcgctatgaaacccgggaggaggcgtggcacgcactactcagattcgttcgccag
gcaccactgaagcgtattgacgtgggcattgcccaagtcaatttgggttggaatggccat
cttttcccttctttttatgatgtttttgaccctaacaccaatttgcgtgtcgctgcgcag
atccttcgtgcctgctatgaaaaccgcgcgggtagctggataaacgcagcgggctgctat
caccatcctgccggtggaaaacccgctgctaattatatcgccattgtgcgtcgcaaatta
gacaccctggctccagtacacattgcagtatcaagcaagacgaccatctctgatgttaca
tcggttaaccatccactcatctggattgagccaaaatga

DBGET integrated database retrieval system