KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_4027Help
Entry
YpsIP31758_4027   CDS       T00570                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ypi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YpsIP31758_4027
Enzymes [BR:ypi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     YpsIP31758_4027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer
Motif
Other DBs
NCBI-ProteinID: ABS49311
UniProt: A0A0U1R243
Position
complement(4533815..4534498)
Genome map
AA seq 227 aa AA seqDB search
MKRSEVNQILKQTGHFFARHHIQLPPFARFTPQIWQQLDPKAWQELFDLKLGWDITAFGG
NHFFTQGLTLFTLRNGSVSGTPYPKCYAEKIMHVREGQVTPMHFHWRKQEDIINRGGGNL
IVELWNSDAFEQTEKSDVTVTLDGCRQTHAAGSQLRLSPGESICLVPGVYHSFWGEVGYG
EVLVGEVSMVNDDDHDNRFMKPLERFNSIIEDEPAELVLCNEYCRFV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctccgaggtcaaccaaatccttaagcagaccggtcatttctttgcccgacac
catatccagctaccgccatttgcccgtttcacgccacaaatatggcaacagcttgaccct
aaagcctggcaagaactgtttgacctgaaactcggctgggatattaccgcattcggcggg
aaccatttttttactcagggattaacgctgttcaccttacgcaacggttcggtaagcggc
actccttaccctaaatgctacgccgaaaaaatcatgcacgtccgcgaaggccaggtgaca
cctatgcattttcactggcgtaaacaggaagatatcatcaaccgtggcggcggcaatctt
atcgtcgagctatggaattccgacgcgtttgaacaaacggagaagagcgatgtcaccgtg
acactcgacggctgccgccaaacccatgcggcaggcagccagttacgcttatctcccggt
gaaagcatttgcctggtgcctggggtgtaccacagtttctggggcgaggtaggttacggt
gaggtgctggtcggtgaggtatcgatggtaaatgacgatgaccacgacaaccgatttatg
aaacctcttgaacgttttaattcgattattgaagacgaaccggctgaacttgtgctgtgt
aatgagtactgccgtttcgtctga

DBGET integrated database retrieval system