KEGG   Yersinia pestis Harbin35: CH55_2753Help
Entry
CH55_2753         CDS       T03717                                 

Gene name
glyS
Definition
(GenBank) glycine--tRNA ligase, beta subunit
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CH55_2753 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ypj01007]
    CH55_2753 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypj03016]
    CH55_2753 (glyS)
Enzymes [BR:ypj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     CH55_2753 (glyS)
Amino acid related enzymes [BR:ypj01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CH55_2753 (glyS)
Transfer RNA biogenesis [BR:ypj03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CH55_2753 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AJK06450
UniProt: A0A3N4AYN6
Position
complement(3008253..3010322)
Genome map
AA seq 689 aa AA seqDB search
MTQQTFLVEIGTEELPPKALRSLAESFAANFTAELDNANLSHGEVSWYAAPRRLAVKVAN
LSAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQAERLVTDKGEWLLYRA
HVKGQPAQLLLAGMVNTALSKLPIPKLMRWGDKETQFVRPVHTVTLLLGTEVIPGTVLGI
NSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYELRKSIIKRDAEQAAQQIGGV
ADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTMKGDQKYFPVYDTAGHLMPH
FIFVANIESKDPQQIISGNEKVVRPRLADAEFFFKTDRKKRLEDNLPRLETVLFQQQLGT
LRDKTDRIQALAGWVAAQIGADVNHATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHD
GEAEDVAVALNEQYQPRFAGDDLPSNPVACALAIADKMDTLAGIFGIGQHPKGDKDPFAL
RRAALGVLRIIVEKNLSLDLQTLTEEAVRLYGSKLTNAKVVDDVIEFMLGRFRAWYQDEG
HSVDTIQAVLARRPTKPADFDARVKAVTYFRTLDAAAALAAANKRVSNILAKSTDTLNDH
VHASILKEPAELKLATHLVVLRDQLEPVFAAGQYKEALVELAALRETVDEFFESVMVMAE
DDAVRVNRLTLLSKLRELFLQVADISLLQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacagactttcctggtggaaatcggcacggaagagctgccgccgaaggctctt
cgttctctggccgaatcttttgccgctaattttacggctgaactggataacgctaatttg
tctcacggtgaggtgagttggtacgccgcgccgcgccgtctggcagtaaaagtggccaat
ttaagtgcggctcaggctgatcgtgaagtcgaaaagcgcggcccggccattgcgcaagcg
tttgatgctgaaggtaaacctagcaaagccgctgaaggttgggcgcgtggttgtggtatt
acagtcgatcaggcggagcgtctggtgacggataaaggcgagtggctgctgtaccgtgcc
catgtcaaagggcaacccgcccagttattgctggcaggcatggttaatactgcgctgagt
aagttgccaattccaaagctgatgcgttggggtgataaagaaactcaattcgtccgtccg
gtgcataccgtgaccctgctcttggggactgaagttattcctggcaccgtgctgggtatc
aattcagatcgggtgatccgtggccatcgctttatgggtgaagcggaattcacgatcgac
agtgctgaccaatatccacagattctgctggagcgtggcaaggtcattgctgattatgaa
ttgcgtaaatcaatcattaagcgtgatgcagaacaggcagcgcaacagattggcggtgtt
gctgatctgagtgaaagcctgctagaggaagtggcgtcattggtggagtggccggtggtg
ctcaccgccaagtttgaagagaaattcctggctgtccctgcggaagcgctggtgtacacc
atgaagggtgatcagaagtatttcccggtttacgatactgccggccacttgatgccacac
ttcatttttgtcgccaacattgagtctaaagaccctcaacaaatcatttctggcaatgag
aaggtggttcgccctcgtttggctgatgctgagttcttctttaagaccgaccgcaaaaaa
cggttggaagataatttaccgcgtctggaaaccgtgctgttccaacagcaactgggtacc
ctgcgtgataaaacagatcgtattcaggcgttggcgggttgggttgccgcacaaattggc
gctgatgttaatcacgccacccgtgcgggtctgttgtccaagtgtgacctgatgaccaac
atggtattcgaattcaccgatacccaaggcgtgatggggatgcactacgcccgccacgat
ggtgaggctgaagacgttgccgttgcattgaatgaacaatatcagccacgctttgccggt
gatgatttgccgtctaacccggtcgcttgtgcgctggccattgccgataagatggacaca
ctggcgggtatcttcggtatcggtcaacatccgaaaggcgataaagatccgtttgctctg
cgccgtgcggcgttgggtgtactgcgcattatcgtcgaaaagaatttgtcactggatctg
caaacactgacggaagaggcggtgcgcctgtacggcagtaagctgaccaatgcgaaagtg
gtcgatgacgtgattgaattcatgctgggccgtttccgtgcctggtatcaggatgaaggt
catagcgtcgataccattcaggcggtcttggctcgtcgtccgaccaaaccggctgatttt
gatgcgcgagtgaaagcggtgacctatttccgcacactggatgctgctgccgcattggct
gctgccaacaaacgtgtatcaaacattctggcaaaatccacggataccctgaatgaccat
gttcatgcttcgatcttaaaagaaccggcagagctaaaactggcgacacatttggtggta
ttacgcgatcaactggagccggttttcgcggctggtcagtataaagaggcgctggttgaa
ttagctgcgttgcgggaaactgtcgatgagttcttcgagagcgtgatggtgatggctgaa
gacgatgctgtgcgggttaaccgtctgacattgctgagcaaactccgcgaactgttcttg
caggttgctgatatttcgctgttgcaataa

DBGET integrated database retrieval system