KEGG   Yersinia pestis Harbin35: CH55_2953Help
Entry
CH55_2953         CDS       T03717                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CH55_2953 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ypj03011]
    CH55_2953 (rplV)
Ribosome [BR:ypj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CH55_2953 (rplV)
  Bacteria
    CH55_2953 (rplV)
  Archaea
    CH55_2953 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: AJK07156
UniProt: A0A3N4AX35
Position
3223153..3223485
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgcttggta
gcggacctgattcgcggtaagaaagtgtcgcaagctctggaaactctaacctacaccaac
aaaaaagctgctggtttggttaagaaggtactagagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtcacgaagatcttcgtagacgaaggccct
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system