KEGG   Yersinia pestis Harbin35: CH55_3792Help
Entry
CH55_3792         CDS       T03717                                 

Gene name
glnD
Definition
(GenBank) protein-P-II uridylyltransferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
ypj  Yersinia pestis Harbin35
Pathway
ypj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CH55_3792 (glnD)
Enzymes [BR:ypj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     CH55_3792 (glnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase ACT HD NTP_transf_2 DUF294 Polbeta ACT_4
Motif
Other DBs
NCBI-ProteinID: AJK09889
UniProt: A0A2S9PB67
Position
complement(4153378..4156059)
Genome map
AA seq 893 aa AA seqDB search
MSDNHTEHSLSLTLTPTISEQPALPSTYLDSDIHCPILKQRLDAFQRWQAEAFNSGTSAE
VLIAARSDYIDHLLQRLWTFYGFDKVPETALVAVGGYGRGELHPLSDIDVLVLSKQRLND
EQAQRVGQLITLLWDLKLEVGHSVRTLEECLLEGLADLTIATNMIESRLICGDVALFLQM
QKHIFSDSFWPSPQFFHAKVVEQQERHKRYHGTSYNLEPDIKSSPGGLRDIHTLLWVARR
HFGATSLSEMVDFGFLTNAERNELNESQSFLWRIRFALHLVLTRYDNRLLFDRQLSVAQL
LRYEGEGNEPVEHMMKDFYRMTRRVSELNNMLLQLFDEAILALDANEKPRPLDEEFQLRG
DLIDLRDENLFVRQPEAIMRMFYLMVRNQDIKGIYSTTVRRLRHARRHLKAPLCHIPEAR
KLFMAILRHPGAVSRALLPMHRHSVLWAYMPQWGSIVGQMQFDLFHAYTVDEHTIRVLLK
IESFADEDTRPRHPLCVELYPRLPQPELLLLAALFHDIAKGRGGDHSILGAHDAVEFAEQ
HGLNSRESQLVAWLVRCHLLMSVTAQRRDIQDPAVIQQFSAEVQSETRLRYLVSLTVADI
CATNENLWNSWKQSLLRELYFATEKQLRRGMQNSPDLRERVRHHRLQALALLRMDNIDEE
ALHRIWSRCRADYFLRHSPNQLAWHARHLLEHDSTKPLVLVSRQATRGGTEIFIWSPDRP
SLFAAVVGELDRRNLSVHDAQIFTNRDGMAMDTFIVLEPDGSPLAQDRHPIISHALQQAI
NRSDYQHPPRVRRLSPKLRHFSVPTEANFLPTHNERRTYLELIALDQPGLLARVGKIFAD
LGLSLHSARITTIGERVEDLFVLADKDRRALSLETRRELAQRLADTLNPNDKL
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaatcacaccgaacactccctatcgctgacgctcactcccactatttctgag
cagcccgcacttcccagcacttatcttgatagcgacatccattgcccgatactgaagcaa
cggcttgacgctttccaacgctggcaggcagaggcatttaatagtggcacctctgccgag
gtattaattgcggcacgcagtgattatatcgatcatctgttacagcggttgtggacattc
tatggttttgacaaggtgccagaaacagctctggttgcggtcggtggctatgggcgcggc
gaactgcatccattatcagatattgatgtgttagtactgagtaagcagcgtctaaatgat
gaacaggcgcaacgggttggccaactcattaccttattgtgggatttgaagctggaagtc
ggtcatagtgtgcgcacactggaagagtgcttgctggaaggcctcgcagatttaaccata
gccaccaatatgattgagtcacggttgatttgcggtgatgtcgccctttttttacagatg
caaaaacatattttcagtgacagtttctggccctcccctcaatttttccatgcaaaagtt
gttgaacagcaagagcgtcataaacgctatcacggcaccagctataatctggaacccgat
atcaaaagtagccctggtggattacgggatatccacacattactctgggttgcccgtcgc
catttcggtgcgacatcgttaagtgaaatggttgattttgggtttctcaccaacgccgag
cgtaatgaactgaatgaaagccagagttttttatggcgtatccgttttgcgctgcacctg
gtattgactcgctacgataaccgcctgctgtttgaccgccaactgagcgttgctcaactt
ttacgctacgaaggtgaaggcaatgagcccgttgaacatatgatgaaagatttctatcgt
atgacaaggcgtgtcagtgaactgaacaatatgctgctgcaattgtttgatgaagccata
ctggcattagatgcgaatgaaaaaccgcgtccacttgacgaagagtttcaactacgggga
gatttaattgatctccgtgatgagaacctatttgttcgtcagcctgaagcgatcatgcgg
atgttctatctgatggtgcgcaatcaggatattaaaggtatttactccactaccgtccgg
cgtttgcgccatgcccgtcgtcatctgaaagcccctttatgtcacattcctgaagctcgt
aaactgttcatggccattttgcgccaccccggtgccgtttcacgtgcgttgctgcccatg
catcgtcacagtgttttatgggcctatatgccgcaatggggcagtattgttggccaaatg
caatttgatctatttcatgcttatacggtggatgaacacaccatccgtgttttgctaaaa
attgaaagcttcgcggatgaagatacccggccacgtcatccactctgcgtcgaactctac
cctcgcctgcctcagcctgaattactgctgctggccgccctgtttcatgatattgccaaa
gggcgtggcggtgatcattcaatactgggtgcccacgacgcggtggagtttgctgaacag
catgggcttaattcacgcgaatcccaattagtcgcttggttagttcgctgccatttattg
atgtcagtgaccgcccaacgtagggatattcaggacccggccgttattcagcaattttct
gccgaagtgcaaagtgaaacgcgcctgcgctatctggtcagcctgaccgtggcagatatt
tgcgccaccaatgaaaatctatggaatagctggaaacagagcctgttacgcgaactgtac
tttgcgaccgaaaaacagctacgccgcggaatgcaaaatagccctgatttacgtgagcgt
gtacgccaccaccgcctgcaagcgttagctctactgcggatggataatattgatgaagag
gcactgcatcgtatctggagccgttgccgagcggattacttcctacgccactcgccgaat
caacttgcctggcacgcccgccatttgctggagcacgactcaaccaaaccgctagtctta
gtcagccgtcaggctacccgtggtgggactgaaatatttatctggagccctgaccgccca
tcactctttgccgctgttgttggggagcttgatcgccgcaacttgagcgtccatgacgca
caaattttcaccaatcgtgatggtatggcgatggatacctttattgtattggagccagat
ggcagcccgttggcacaggataggcatccaataatcagccatgcattacagcaagcgata
aaccggtcagattaccaacacccgccgcgggttaggcgattatcacctaaattacggcat
ttcagcgtgccaaccgaagctaactttttaccaacccataacgagcggcgtacttatctg
gaattaattgcgttagatcaaccagggttactggcacgtgttggcaaaatttttgctgat
ttagggttatcactgcacagtgcacgtatcaccaccatcggcgagcgagtagaggattta
tttgttttagcagataaagatcgtcgagcactgagccttgaaacccgtcgtgaattagca
caacgattggcagatactctcaatccaaacgataaactgtga

DBGET integrated database retrieval system