KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0297
Entry
y0297             CDS       T00092                                 
Symbol
cytR
Name
(GenBank) regulator for deo operon, udp, cdd, tsx, nupC, and nupG
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ypk03000]
    y0297 (cytR)
Transcription factors [BR:ypk03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    y0297 (cytR)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_Tnp_ISL3 HTH_Crp_2 TetR_N HTH_3 DUF3606 HTH_24 TrmB
Other DBs
NCBI-ProteinID: AAM83889
UniProt: A0A3G5L0Z1
Position
complement(315809..316837)
AA seq 342 aa
MENKKEFTMTTMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVEQAVLAVGYSPHALSR
NIKRNESRTILVIVPDISDPFFADVIQGIEHAAAQQGYLILIGDCAQQTQQERTFVNLII
TKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPTVHIDNLTAAYEAVNYLH
ELGHKRIACIAGPESLPLSHYRLQGYIQALRRNGITVDNDYIIRGDFSYEAGAQSFAALM
ELPHPPTAIFSHNDVMAVGAIWQAKQLGLRIPQDVSLVGFDDLKLSQFCDPPLTTVAQPR
YQIGQQAMLLLLEQLQGHSVQSGSRLLDTELIIRESTAAPKH
NT seq 1029 nt   +upstreamnt  +downstreamnt
ttggaaaataagaaagaattcacaatgaccacgatgaaagatgttgctgaaatggcaggt
gtatcaacagcaaccgtgtctcgcgcgttgatgaaccctgaaaaggtttcaaccgtgacc
cgacaaaaagtggaacaagccgttttggctgttggttattctcctcatgctttatcccgt
aatattaagcgtaatgaatcacgtacgattctggtgatcgtacccgatatcagtgaccca
ttttttgccgatgtcattcagggcattgaacacgcagccgcccagcaaggctatctgata
ttaattggtgattgcgcacaacaaacccagcaagagcgcacatttgttaatctgattatc
accaaacagatcgatggcatgctgctattaggctctaacctgccttttgatgccagtaaa
gaagagcagcgaaatttacccccgatggtcatggcgaatgagtttgctcctgagttggag
ctgccgaccgtacatatcgataacctgaccgccgcttatgaagccgttaactatttgcat
gagttgggccataaacgcatcgcctgtatcgccgggccagaaagcctgccgctgagccat
tatcggttacaaggttatattcaggcactgcgtcgtaatggtattactgtcgataatgac
tatattatacgcggggatttcagctacgaagcgggggcccaaagctttgcggctcttatg
gagctgccccacccccccactgcaatattttctcacaatgatgtcatggcagtaggggct
atctggcaggcgaagcaattagggttacgtatcccgcaggatgtctcgctggttggcttt
gatgacttgaagctgtcacagttttgtgaccccccattaactaccgtcgcacaaccccgt
taccagattggccagcaagccatgttactcttactggagcaactgcaagggcattcagta
caaagtggctcccgcttgttagataccgaattaatcatcagggaaagtactgctgcgcct
aaacactag

DBGET integrated database retrieval system