KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2189
Entry
y2189             CDS       T00092                                 
Name
(GenBank) putative phage tail protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB
Motif
Pfam: Lambda_tail_I
Other DBs
NCBI-ProteinID: AAM85750
UniProt: A0A5P8YFB6
Position
complement(2423266..2423886)
AA seq 206 aa
MTLFAQEVMTPIKLSGSLAKMFGRDHQRLVGSSGEVIKALCVTIPGFEQYLMTAKQRGLT
FAVFKNKRNVGKDELELASGGQEIRIVPVIIGSKRGGLFQTILGVALIGMATFMSGGLAV
AFGAGGVWGGAMAMMGASMALGGVIQMLSPQQSGLAMRQSPDNKPSYAFGGPVNSTAQGN
PVGVLYGKRRIGGAVISAGIYAEDQM
NT seq 621 nt   +upstreamnt  +downstreamnt
atgactttatttgcgcaagaagtaatgacaccaatcaaactaagcggttcattagctaag
atgttcggtcgcgaccatcaacgattagttggtagctctggcgaagttattaaggcttta
tgcgtaactattcctggctttgagcaatacctgatgacggctaagcagcgtggactcacg
tttgctgtattcaaaaataagagaaatgtcggcaaggatgagttggagcttgcaagtggt
ggacaagaaattcgtattgttcctgtaattatagggagcaaacgcggtgggctgttccag
accatactcggcgtagctttaatcggtatggcaacatttatgagtggaggcttggcggtg
gcgtttggcgcgggtggagtatggggtggtgcaatggcaatgatgggcgcatccatggcc
cttggcggcgttatccaaatgctatcaccgcagcagagtgggttagccatgaggcaatca
ccagacaacaagccaagctatgcattcggcggcccggttaactctacggctcagggtaac
ccggtgggcgtactctacggcaagcgtcgaattggcggggcggttatctcggcgggtatt
tatgctgaagatcaaatgtaa

DBGET integrated database retrieval system