KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2790
Entry
y2790             CDS       T00092                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase 1
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00620  Pyruvate metabolism
ypk00640  Propanoate metabolism
ypk00650  Butanoate metabolism
ypk01100  Metabolic pathways
ypk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    y2790 (pflB)
   00640 Propanoate metabolism
    y2790 (pflB)
   00650 Butanoate metabolism
    y2790 (pflB)
Enzymes [BR:ypk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     y2790 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: AAM86342
UniProt: Q8D044
Position
3087330..3089684
AA seq 784 aa
MTSNINVWPLRLVFEKLTLKGRCIMTELNEKLAKAWHGFTKGDWQNEVNVRDFIQKNYTP
YEGDESFLAGSTEATDKLWAQVMEGIKLENRTHAPVDFDTDVASTIISHDAGYINKDLET
IVGLQTEAPLKRALIPFGGIKMVEGSCKVYGRELDPQLKKVFTEYRKTHNQGVFDVYTKD
ILNCRKSGVLTGLPDAYGRGRIIGDYRRVAVYGIDFLMKDKLAQFNSLQADLENGKDLEM
TIQLREEIAEQHRALAQIKEMAAKYGCDISGPATNAREAVQWTYFGYLAAVKSQNGAAMS
FGRVSTFLDVYIERDMKEGKLTEIEAQELIDHLVMKLRMVRFLRTPEYDELFSGDPIWAT
ESLAGMGVDGRTLVTKTSFRFLNTLYTMGPSPEPNMTILWSEKLPLNFKKYAAKVSIDTS
SVQYENDDLMRPDFNNDDYAIACCVSPMIVGKQMQFFGARANLAKTMLYAINGGVDEKMK
IQVGPKEAPMMDEVLDYDKVMERMDHFMDWLAKQYITALNIIHYMHDKYSYEAALMALHD
RDVYRTMACGIAGLSVAADSLSAIKYAKVTTIRDADGLAVDFNIEGEYPQFGNNDSRVDD
IACDLVERFMKKIQKLRTYRNAVPTQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGANP
MHGRDQKGAVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDDEVRKANLAGLMDGYFHH
EASIEGGQHLNVNVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNALTKEQQQDVITRTF
TQSI
NT seq 2355 nt   +upstreamnt  +downstreamnt
gtgaccagcaacattaacgtgtggccgctacgtctggttttcgagaaattaacattaaaa
ggtagatgcattatgaccgaacttaatgagaaattggccaaagcatggcacggttttacc
aagggtgattggcagaatgaagtcaacgttcgtgactttatccagaaaaactacacccct
tatgaaggtgatgaatccttccttgccggctctaccgaagcgaccgacaagctgtgggcg
caagttatggaaggtatcaaactggaaaaccgcactcatgcgccagtggatttcgatacc
gacgtagcatcaaccattatctcccacgatgcaggctacattaataaagatctggaaact
atcgttggtttacagactgaagcgccattgaaacgtgctctgatcccattcggcggcatc
aaaatggtcgaaggctcttgtaaagtttatggtcgtgagcttgatccacaactgaaaaaa
gtcttcaccgaataccgtaaaacacataaccaaggtgtgtttgacgtttataccaaagac
atcctgaactgccgtaaatcgggtgtgctgactggcctgccagatgcgtatggccgtggc
cgtatcatcggtgattaccgtcgcgttgcggtatacggtatcgacttcctgatgaaagac
aaactggctcagttcaattcactgcaggctgatttagaaaacggtaaagacctggaaatg
actatccagttgcgcgaagaaattgctgaacagcatcgcgctctggctcaaatcaaagag
atggcagctaaatacggctgtgatatttcaggtccggcaactaacgcccgcgaagcagtt
cagtggacttacttcggctatttggctgcagttaaatcccagaacggcgcagcaatgtcc
ttcggtcgtgtttctaccttcctcgatgtgtacatcgaacgtgatatgaaagaaggtaaa
ctgactgaaatcgaagcgcaggaactgattgaccatttggttatgaaactgcgtatggtt
cgtttcctgcgtacgcctgaatatgatgagctgttctctggtgacccaatctgggcaacc
gagtctttggcaggtatgggcgttgatgggcgtactctggtcactaaaaccagcttccgc
ttcctgaataccctgtataccatggggccatccccagagccgaacatgaccattctgtgg
tctgagaagctgccactgaacttcaaaaaatatgctgctaaagtgtctatcgatacttca
tctgtacagtatgaaaacgatgacctgatgcgtcctgacttcaacaacgatgactacgct
atcgcatgttgtgtcagcccaatgattgtgggtaaacaaatgcagttcttcggcgcccgt
gccaacctggctaaaaccatgttgtacgcaatcaacggcggcgttgacgaaaaaatgaag
atccaggtgggtccgaaagaagcgccaatgatggatgaagtgctggactatgacaaagtc
atggaacgcatggatcactttatggattggctggctaaacaatacattactgcgttgaac
atcattcactacatgcatgacaagtacagctatgaagctgccctgatggcgctgcatgac
cgtgatgtttaccgtactatggcatgtggtatcgcaggtctgtctgttgccgctgactcc
ctgtctgctatcaaatatgccaaagtaaccactatccgtgatgctgatggcctagctgtt
gacttcaacattgaaggtgaatatccacagtttggtaacaacgactcacgtgttgatgat
attgcctgtgatctggttgagcgcttcatgaagaaaattcagaagctgcgtacctaccgc
aatgcggttccaactcagtccgtactgaccatcacatctaacgttgtttatggtaagaaa
acaggtaacaccccagatggccgccgcgctggtgctccatttggcccaggtgccaaccca
atgcacggtcgtgaccaaaaaggtgcggttgcctctctgacttccgtggctaaactgccg
tttgcttacgctaaagatggtatctcttacaccttctctatcgtgccaaacgcactgggt
aaagacgatgaagtccgtaaagctaacctcgccggtctgatggatggctacttccaccac
gaagcgtccatcgaaggtggtcaacacctgaacgtgaacgtaatgaaccgtgagatgctg
ttagacgcgatggagaacccggaaaaatatccgcagttgaccattcgtgtatctggttat
gctgttcgcttcaacgcgctgaccaaagaacagcagcaggatgtgattacccgtaccttt
acacagtcaatctaa

DBGET integrated database retrieval system