KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0036Help
Entry
y0036             CDS       T00092                                 

Definition
(GenBank) hemolysin co-regulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y0036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y0036
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AAM83631
UniProt: A0A5P8YK90
Position
complement(49742..50260)
Genome map
AA seq 172 aa AA seqDB search
MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFEHIVTVPTDPQSGQPS
GQRAHKPLRFTVAYNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATI
IDIDCKMPHCQDSTKAEFTQLVRVSLAYRKINWDHTTAGTSGADDWRAPIEA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccaactccagcttatatctctatcacagggaaaacgcagggcaatattaccgcaggt
gctttcacagctgaatccgtcggtaatatctatgttcaaggtcatgaagacgaaatgttg
gtacaggagtttgagcacattgtgacggtgcctaccgatcctcaatccggccagccttcc
ggccaacgtgcgcacaaaccattgcgtttcactgttgcgtacaacaaagccgttccattg
ctgtataacgcattagcctctggtgaaatgctgccaacagtggaattgaagtggtaccgc
acctcgattgaaggcaaacaagagcatttcttcacgactaaactggaagatgccaccatt
atcgacattgattgtaaaatgccgcattgtcaggattccaccaaggctgagtttactcaa
ttagtccgtgtatcactggcataccgcaagattaactgggatcacaccaccgcgggcacc
tctggtgctgatgactggcgtgcgccgatcgaagcgtaa

DBGET integrated database retrieval system