KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0040
Entry
y0040             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11896  type VI secretion system protein ImpG
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y0040
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y0040
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AAM83635
UniProt: Q8CLW8
Position
53277..54503
AA seq 408 aa
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKID
DQFPELTHGLLNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQR
SAFINSNAHAGPQCTFTLCRDVWLFPMSIREISANSSNEQGILSIHFAAKAELNLQDLQL
DKLRFYLGEDNYTSTQLYFWINHYFERAELVVNGITIPMPDFDFNPVGFERDDALLPYPK
NAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFSLNLYFSQALPPEVKVRSTTL
RMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSWLSEKGVPKGR
GRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVIMDIFYNVTL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgtcgttcgaaaagtatttcagggacgagctggactacctccggcaattaggacgcgat
gccgcaatagaacggcctcatctcgctgcatttttatctgagcaaggttctgatccggat
gttgaacgtttgctggaaggctttgcttttctaacgggcaacctgcgtgaaaaaatcgat
gatcaattccctgaattgactcatggtttactgaatatgttgtggccgaactacttacgg
ccaataccgagcatgaccatcatcgagtacacaccggatgaaagtgtggtcaccgaggcg
acgctggtgaaacggggtagccaagtgatgagtatccccatcgcacaaaatggtcagcgc
agcgcgtttatcaacagtaatgctcatgccgggccacaatgtacttttacgttgtgccgt
gatgtgtggttgttccccatgtccatccgggagatctcggcgaacagcagtaacgaacaa
ggcattttgagtattcactttgccgccaaagcggaattgaacttacaagacctgcaattg
gataaattgcgcttttatctgggcgaagacaactacaccagcacacaactctatttctgg
attaaccactatttcgaacgcgctgaactggttgtcaacgggataaccatcccgatgcct
gattttgactttaacccagtgggctttgaacgcgatgatgccctcttgccgtacccgaaa
aacgcctatatgggttaccggatcctgcaagaatatttttgcttccccgaaggctttttg
ttctttgatgtcaatggtgtggtcgattttccgccgcacttgaatgccagtgaattctct
ctgaatttgtatttctctcaggcattgccgcctgaagtgaaagtccgctccaccacactg
cggatgaattgcacacctgcggtgaacctgttccaacatgacagtgaagcgattgatctt
gatggaacccagacggaatatccgctctgtgtcagctaccataatccggatcactacgac
atcttttcagttgatcgggttgacagttggctcagtgaaaaaggtgttcctaaggggcgc
ggccgtgcactgaaccccaaaacttggacatctgctttactgcttttctacctgagtccg
gtattctgccggactcattccgcctgttttcaggctaatgcgctctgtattgtaataatg
gatatattctacaatgtcacgctttaa

DBGET integrated database retrieval system