KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0069Help
Entry
y0069             CDS       T00092                                 

Gene name
cpxA
Definition
(GenBank) probable sensor protein, histidine protein kinase
  KO
K07640  two-component system, OmpR family, sensor histidine kinase CpxA [EC:2.7.13.3]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk01503  Cationic antimicrobial peptide (CAMP) resistance
ypk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    y0069 (cpxA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    y0069 (cpxA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ypk01001]
    y0069 (cpxA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ypk02022]
    y0069 (cpxA)
Enzymes [BR:ypk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     y0069 (cpxA)
Protein kinases [BR:ypk01001]
 Histidine kinases
  OmpR family
   y0069 (cpxA)
Two-component system [BR:ypk02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   y0069 (cpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA CpxA_peri HAMP HATPase_c_3 HATPase_c_2 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AAM83663
UniProt: A0A380PI87
Position
77767..79143
Genome map
AA seq 458 aa AA seqDB search
MINSLTTRIFAIFWFTLALVLMLVLMVPKLDSRQLTVLLDSEQRQGTMLEQHIEAELAND
PANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEVQMVRNFIGQSDNADQPKK
KKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLMFDRPLLLLIATMLISAPLLL
WLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEFLATGASFNQMISSLDRMVVAQQ
RLISDISHELRTPLTRLQLATALMRRRHGEGKELERIEMEAQRLDSMINDLLVLSRSQHK
NELHREPIKADELWSDVLENAQFEAEQMGKTLVVTAPPGPWPLFCNPAALDSALENIVRN
ALRYSHHHIAVAFSIDNQGVTIIVDDDGPGVSPEDREQIFRPFYRTDEARDRASGGTGLG
LAIVETAVSQHRGWVKAEDSPLGGLRLIVWLPLHPLKS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgataaacagtttaacgacgcgaatttttgctattttctggtttactttagcgttagtg
ctcatgctagtgctgatggtgccaaagcttgattcgcgtcaactcactgttttactcgac
agtgaacagcgtcagggaacgatgctggaacaacatattgaagctgaactggccaatgat
cctgccaatgacctcatgtggtggcgtaggctacaccgcgccattgagaaatgggctccg
cctgggcaacatttgattttggtgacgtctgagggccgtatcattggcgtacagcgtcaa
gaagtgcaaatggtgcgtaactttatcggccaatcggataacgccgatcagccgaaaaag
aaaaagtatggccgggtagaaatggtcggtcccttttccatcagggacggcgaagataac
tatcagctttatctaatacgccccgccaatagtccgcaatctgattttattaatctgatg
tttgaccgcccgctgctgctcttgattgcgaccatgttgatcagtgcaccgctgctactt
tggttggcatggagcctggcgaaacctgcccgcaagctgaaaaatgcggctgatgatgtg
gcccgaggtaacctgaaacaacatcctgaactggaatccggtccacaggaatttttagcc
acaggtgccagtttcaaccagatgatcagttcgttagacagaatggtcgtcgctcaacaa
cggctgatttcagatatttcccatgagttacgcacaccacttacccggctgcaactggcc
accgcgctgatgcgccgccgtcatggtgaagggaaagaattagagcgtatcgaaatggaa
gcacagcgcttagatagcatgattaatgacttgctggtgttatcgcgtagccagcataaa
aatgaattacaccgcgaacccattaaagctgatgagctttggtccgatgtgctggagaat
gcacagttcgaggctgaacaaatgggtaaaacgctggtagtcacggcacctccggggcca
tggcccttattttgtaatcctgcggcccttgacagtgcgctggagaatatcgtgcgtaac
gcactgcgttactcccatcatcatattgcggtggcattcagcatagataatcaaggcgtc
actatcattgttgatgatgatggtccaggcgtcagcccagaggaccgtgaacaaatattc
cggccattttatcgtacagatgaagcccgagatcgggcgtcgggaggaacaggattgggc
ctggcaattgttgaaaccgcggtgagtcagcatcgagggtgggtaaaagccgaagatagc
ccattaggtggcttacgcctgattgtctggctaccgctgcatccgcttaaatcttaa

DBGET integrated database retrieval system