KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0268
Entry
y0268             CDS       T00092                                 

Definition
(GenBank) VgrG-like protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y0268
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y0268
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Ribosomal_L5e
Other DBs
NCBI-ProteinID: AAM83862
UniProt: A0A5P8YKX7
Position
complement(283521..285923)
AA seq 800 aa
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALDAKAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQA
AEVAKTALEAKAKVLDGGVTPMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASL
PPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGM
VASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEIITTLLKENGINDFAFG
FRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLPKGASLP
YNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGP
PGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDF
LHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFM
HAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSNTIQNDRRVEVTRDQQTEVGN
DYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNAGITITHDGAI
VLQGKYIRLAADMIDLNPEE
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgtttgctcatgataaagctaataataataaagccgcggacaagaccggcacggtgacg
ccgacccatatcgtctcgccggaggccgccccaaccgtgagtggcgctcagatgaccgag
atggccggggggattggggatgcggtgggcggcactgccggtaagcgcatcaatcaggcc
gccgaggtggcaaaaaccgccctggatgccaaagcaaaagtactggacggcggcgtcacg
ccgacgaacattgtggccactggcccggccccaaccgtgagtggcgctcaaatgaccgag
atggccggggggatcggggatgcggtgggcggtactgccggtaagcgcattaatcaggcc
gccgaggtggctaaaaccgccctggaggccaaagcaaaagtactggacggcggcgtcacg
ccgatgaatctggccgcgggcggggccggtgcgggattgccggacagcgccgcggcggcg
atatcccgcctggtcaaacagccctccggcctgcaatttaccctgacgacggccagttta
ccgccccagacctttgcggtggtggatttcaccctgagcgagatgctctcctcgccgttt
gtgctcaatgtcgggctggcgagtgccgatccggcggtggattttgcggcggtattggat
gaagacgccacgctgtttatctggcgcgaaggggtactgcaacgcagcatcaccggcatg
gtcgccagctttgaacagggcgataccggttttcatcagacccgctacagcatggtgatc
cgcccggcgctgtggcgcaccagcctgcggcgcaatgcccgcatcttccagcaagcctcg
gtggaagagatcatcaccaccctgctgaaagagaacggcatcaacgattttgcttttggt
tttcgccacccgcacccggtgcgcgagttctgcgtgcaatatcaggagtccgattttgat
tttatccagcgcctgacggcagaagaggggattttctactacttcgagttcagcgccggg
aaaaataccgtggtgtatgccgatgatgttggctccctgccgaaaggcgcgtcactgccc
tataacccgaatgtggcggcgcaggcgcaggaactgagtatcaccaccttcacccgcagt
gcgcaggtgcgcccggcgatggtgcaactgaaagactacacctttaaaaacccgaactgg
gccgcggccttcagcgaacagtcgggagaactgcaaaaccagcgaccggactacgagcat
tttgattttccggggcgcttcaaagatgcccagcacgggcaggattttacccgctaccgg
ctggacgcgctgcgcaatgacgccaatctggggcagggggccagcaatgattttaccctc
cagccggggcagttgttcagcctgtacaaccacccgcgtggtgatctgaaccacgcctgg
cagttgctcggtattcagcacagcggcaaacagatgcaggcgctggagcaggcatctggc
gatcagggcacggtgctgttcaaccacttcagttttattccgcacacccagacctggcgg
ccgacgccgttggctaaaccggcgatggacggcccgcagatcgccatggtggtggggccg
ccgggggaagagatttactgcgacgaatacggccgcatccgcctgcaatttttatgggat
cgctacgggcagagcaatgacaacagctcctgttggatccgggtaacccagccgtgggcg
ggccagggctggggcatgctggccattccgcgtattggtcaggaagtggtggtggatttt
ctgcacggcgatccggatcaaccgattgtcacggggcggacctatcacgccaacaacatc
ccgccggggtcgttaccggccagtaaaacccagatggcgttccgctcaaaaacccacaaa
ggggaaggctacaacgaaatgcgcttcgaggatgccaaaggcggcgaagggctgtttatg
catgcgcagaaagatatgacgaccatggtgctgaatgatcgcaaaaccgatgtgactcag
gaccattcagagcacattgggcaagatcagtccgtgacggttgtgcgtaaccaaagtaat
acgatccaaaatgatcgccgggtagaggtgactcgcgatcaacaaaccgaagtgggcaat
gattaccagctagtggtgaaaggtgaaaagaaagagtttgtgacgaaaattcgttacacc
gaagtgcatgaagacgaaacgctcacggtgacgaaaagtattaaaatccatgccaaacaa
ggtgatatcagcatatcaaccccgaatgccggaattacgatcacccatgacggtgccatt
gttctgcaagggaaatacattcgtttagcggccgatatgatcgatcttaatccagaggag
tag

DBGET integrated database retrieval system