KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0276
Entry
y0276             CDS       T00092                                 

Definition
(GenBank) putative membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y0276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y0276
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y0276
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AAM83868
UniProt: A0A6B3T811
Position
complement(296431..297198)
AA seq 255 aa
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPD
QLYQQVVTDIRAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLV
HFHNETWGGEKVYVLLERLMGEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFR
RLHHQLQQLRGDAPPTVLYQGGGRLNSRYHLSKRLTIKHLLWGGVSLLVVIYLFYAIHLH
TQSQDILQQLNNLLS
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaaaacagatgctgtgactgacaacacccctttccccgcagcggaagcggtcacctcc
catcggcagtatcagctaccgctacgtggcgaaagcttgaacgcgatgatcgataccgcc
accccattattggggatggtactgcgcctgaaagacatggaaaaccaagcgttaccggac
cagctatatcagcaggtggtgacggatatccgtgctattgagcagtacttgcaaaccaaa
ggctacgaacccggcgcaatcatatctttccgatatgtgctgtgcacattcatcgatgaa
acggcattagggcatggctggaacacccaaaacggttggttacagcaatctctgttggtg
cattttcataatgaaacctggggcggagagaaagtgtacgtcctgctggaacgcttaatg
ggggaacccaagcgttaccaagacctgctggagtttatctatctctgtttttgtttgggt
taccgcggccgctacaaagtgacatcacaaaacggtgatgactttgagcgattgttccgc
cgattgcatcatcaattacagcagttacggggtgatgcgccgccgacggtcctttatcaa
gggggcggtcgtctgaatagccgctaccacttgagtaaacggttgactatcaagcatttg
ttatggggtggcgtgagtctgctggtggtgatttatctgttttatgccatccacctgcac
acccaaagtcaggatattttgcaacagctaaacaatttattgagctag

DBGET integrated database retrieval system