KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0280Help
Entry
y0280             CDS       T00092                                 

Definition
(GenBank) hypothetical
  KO
K11895  type VI secretion system protein ImpH
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Module
ypk_M00334  Type VI secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y0280
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components [MD:M00334]
   y0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG Ferlin_C
Motif
Other DBs
NCBI-ProteinID: AAM83872
UniProt: Q8CLT0
Position
complement(300534..301631)
Genome map
AA seq 365 aa AA seqDB search
MLRMAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAW
QGAAPVATPANEAIRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYY
LDSLAWEDAQNENRLTDFMNVFNHRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVG
LGSEVVRNKLQINHSKMLAYAGLLASPGRAPEVICSLVSHCFNLPDITLHSWQLRKVDIA
PSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLLCINKLTREQFLSFLPNG
ANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDPEQKPSVT
IGVME
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgttacgaatggccggtacagacaggtcaacatgcactgatgtaagtgtggttgaggat
gtaagtggggttgagaatgtaaatggggttgaggcaagacccgaagggcaggcattggat
gtttcacgttataacttttttcaattggtcgaattgctcaaccaattggcggtagcgtgg
caaggtgcggcccctgtggcgaccccagccaatgaagccatccgttttaaatcgaccgcc
agtttagcattcccgaccagagatgtgatcgcactggacacctccgcccgaggtcaattt
gagttagaggtctctttccttggattgcatggcagccaatcgccgctaccaggatattac
ctcgattcgttagcgtgggaggatgcgcagaatgagaaccggctaacggatttcatgaac
gtattcaaccaccgcctgttaacgctactgcatcagatttggcgtaaataccgttactac
atctgctttgacaatggcggtgatgatgcattttcacaacgcatgttctcgctggtgggg
ttaggtagcgaggtcgtccgcaataaattgcagatcaatcacagcaaaatgctggcttat
gcagggctgctggccagccccggcagagcacctgaagtgatttgcagccttgtctcacat
tgcttcaatttgccagatatcaccttacacagttggcagctacgcaaagtggatattgcc
ccctcacagcagaatcgcttggggacgagggtgaaagtccgtggcaagaaatatgatgaa
aaatcagtgcttggcgttaatttctccatcggttcacgggttgcggatcgtagcgggaaa
ttcttgttgtgcatcaataagctgacgcgagaacagttcttatcctttttacccaacggg
gctaattacgcctcgttagtgatgtttgtcgccttcattatgcgcgatcaattcgcgtgg
gatttacgccttgggttggccgagcaacaggtgggcgggatggtgttgggaaccgagcaa
aatagcctattgggctggaccagtatcctcggcgatcccgaacagaaacccagcgtaacg
attggtgtaatggaataa

DBGET integrated database retrieval system