KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0287Help
Entry
y0287             CDS       T00092                                 

Definition
(GenBank) putative secretion permease
  KO
K13408  membrane fusion protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Module
ypk_M00339  RaxAB-RaxC type I secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypk02000]
    y0287
   02044 Secretion system [BR:ypk02044]
    y0287
Transporters [BR:ypk02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   y0287
Secretion system [BR:ypk02044]
 Type I secretion system
  RaxAB-RaxC type I secretion system protein [MD:M00339]
   y0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD Biotin_lipoyl Fib_alpha
Motif
Other DBs
NCBI-ProteinID: AAM83879
UniProt: Q8D1M2
Position
complement(308017..309333)
Genome map
AA seq 438 aa AA seqDB search
MMGITERGMSSNQIFRRDAVEYIRTKWLGKALLTSGYSTTFIAALCAIFLVLLITLIIYG
TYTRRINVNGEVISQPHPINIFSPQQGFITKKWVEVGDIVRKGQHLYQIDVSRTTFSGNV
SLNSLEAINNQLSQIDSIINNTQKNKELTLLNLRQQLAQYQKAHKKSQELVDNAGKGMDD
MRRTMASYGTYQRQGLITKDQLTNQRSLFYQQQNAFQSLNTQLIQESLQIAKLESEISTR
ASDFDNDISQYLFQKGDLKRQLAEVDASGMLLINSPSDGKIENMSVTQGQMVNVNDSLVQ
LTPSDNPYYCLVLWVPNNSVPYINTGDKVNIRYDAFPFEKFGQFPGRIISISNVPVSQQE
IASYNIAPRLPNGGLIEPYYKVIVALDDIHFRYQSKPLMLSNGLKANVTLFLEKRPLYQW
MLSPFYDIKKSVTGPVNE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtataacggagcgaggaatgagcagcaatcagatattccgccgggacgcggta
gagtatattagaacaaaatggttggggaaggcgctgttaacttcgggttattccacaacg
ttcatagctgctttatgtgctatctttttggtgttattaattactcttatcatttatgga
acatacacccgtagaataaacgttaatggtgaggttatttctcagcctcaccccataaac
attttttctccccaacaaggattcattaccaaaaaatgggtggaagtgggtgatattgtc
cgtaaaggtcagcacttatatcaaattgatgtcagtcgaacgaccttttcaggtaatgtt
agccttaactctttagaagcaataaataaccaactttctcaaattgatagcatcatcaat
aatacacagaaaaataaagaacttacgctacttaatttacgtcagcagctcgcacaatac
caaaaggcacataagaaatcccaagagctggtcgataacgcaggcaaaggaatggatgat
atgcggcgtacaatggccagttatggtacttaccaacgtcagggtctaattactaaagat
caattaaccaatcagcgttccctcttttatcaacaacagaatgcctttcaaagcctgaat
actcaactgatacaagaaagcttacagatagcaaaacttgaaagtgaaatctctacgcga
gcatcagattttgataatgatatctctcagtatttatttcaaaaaggtgatttaaagcgt
caattggctgaagttgatgcgagtggcatgttactcattaattcgccaagcgatggcaag
attgaaaatatgagtgtgacccaaggacagatggtcaacgtaaatgacagtttggtccaa
ttgacgccttctgataatccctattattgtcttgtgctttgggtaccaaacaatagcgtc
ccttatataaatactggagacaaagtcaatatacgctatgacgctttcccctttgaaaag
tttggtcaatttcctgggcgtataatctctatctctaatgtccccgtttcacaacaagaa
atagcctcatacaatattgcaccgcggctcccgaacggtggactcattgagccttactat
aaagtcatcgtggcactagacgatattcattttcgttatcagtctaaacctttaatgcta
tccaatggccttaaagctaatgtcacgttattccttgaaaaaaggcctctttatcaatgg
atgctatctccattttatgacatcaagaaaagtgtaacggggcctgtaaatgaatga

DBGET integrated database retrieval system