KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0296Help
Entry
y0296             CDS       T00092                                 

Gene name
ftsN
Definition
(GenBank) essential cell division protein
  KO
K03591  cell division protein FtsN
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ypk03036]
    y0296 (ftsN)
Chromosome and associated proteins [BR:ypk03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    y0296 (ftsN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPOR
Motif
Other DBs
NCBI-ProteinID: AAM83888
UniProt: A0A0H2W2E4
Position
complement(314898..315743)
Genome map
AA seq 281 aa AA seqDB search
MAQRDYVSRGRSGARRKSTSRKKRSAPIVSKTVMALAVALLVVFVGGLYFITHNKPGELP
LLPNHDPRTGNGLPPKPEERWRYIKELENRQIGVPMPTEPSAGGEVNAKTELTNEQRQLL
EQMQADMRQQPTQLSEVPYNQGMQQVPRSAVTIKPPATSVQPQPVTPPRQTTIPVQPQAP
APVRTPPAAPVTQAVTPPKVEKEKEKTQRWMVQCGSFKAVDQAESIRAQLAFAGIESRIT
SGGGWNRVVLGPYNSKAAADKALQRLQGAGQSGCIPLSVGG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaagagattatgtaagccgagggcgctcaggagcgcggcgcaaaagcaccagc
cggaaaaaacgcagtgctccaatagtatctaaaaccgtgatggcactggctgtcgcgcta
ttagtggtgtttgttggcggcctctattttatcacccacaataaaccgggtgagcttccg
ctattgccaaatcatgacccacgtaccgggaatgggctaccgccaaaaccggaagaacgc
tggcgttatattaaagaattggaaaatcgtcagattggcgtacccatgccaacagaaccc
tctgcagggggtgaagtaaacgccaaaacagagttgaccaatgaacaacgtcagttactg
gagcagatgcaggcagatatgcgtcaacaaccgacgcaactttctgaggttccctataac
caaggtatgcagcaggtaccacgttcagcggtaaccatcaaaccaccggccaccagtgta
cagccgcaaccggtaactccgccgcgtcaaaccactattcctgtacaacctcaagcaccg
gcccccgtgcgtacaccgcccgccgcgccagtgactcaggccgttacgccgcctaaagtg
gaaaaagagaaagaaaaaacacaacgctggatggtgcaatgtggctcattcaaagccgtt
gatcaggcagaatctatccgcgctcaattggcatttgcgggtatcgaaagccgtattacc
tcgggcggtggctggaatcgcgtggtgcttggcccctacaatagtaaggctgccgcagat
aaagccttgcagcgtttacaaggtgcaggtcaatcaggatgcattcccctctctgttggg
ggttga

DBGET integrated database retrieval system