KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0303Help
Entry
y0303             CDS       T00092                                 

Gene name
metL
Definition
(GenBank) aspartokinase II and homoserine dehydrogenase II
  KO
K12525  bifunctional aspartokinase / homoserine dehydrogenase 2 [EC:2.7.2.4 1.1.1.3]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00260  Glycine, serine and threonine metabolism
ypk00261  Monobactam biosynthesis
ypk00270  Cysteine and methionine metabolism
ypk00300  Lysine biosynthesis
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
ypk01130  Biosynthesis of antibiotics
ypk01230  Biosynthesis of amino acids
Module
ypk_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
ypk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y0303 (metL)
   00270 Cysteine and methionine metabolism
    y0303 (metL)
   00300 Lysine biosynthesis
    y0303 (metL)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    y0303 (metL)
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     y0303 (metL)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     y0303 (metL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAM83894
UniProt: A0A0H2W0Y3
Position
323032..325467
Genome map
AA seq 811 aa AA seqDB search
MNATAVAAAATGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDLMVVSAAGSTTNQLIS
WLKLSQNDRLSAHQVQQSLRRYQHDLINGLLPPEMAEPLISEFIHDLERLAGLLDNKIDD
VIYAEVVGHGEIWSARLMSALLNKLDMDAVWLDARRFLRAERAAQPQIDESRSYPLLQQL
MAQHPHQRLVVTGFISRNEAGETVLLGRNGSDYSATQVGALAGAERVTIWSDVAGVYSAD
PRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSDIDLQLRCSYQPEQGSTRIE
RVLASGLGAKIVTSHDDVCLIELQIASHHDFSLAQKEIDLLLKRAQIKPLATGIHPDRNL
LQLCYTSEVVNSALRVLEDAALPGKLSLREGLALVALVGAGVSKNPLHSHRFYQQLKDQP
VEFVWQAEDGISMVAVLRLGPTEHLIQGLHQSLFRAEKRIGLMLFGKGNIGARWLELFAR
EQKSLSARSGFEFVLAGVVDSRRSLLSYDGLDASRTLAFYNDEAKEQDEESLFLWMRAHP
FDDLVVLDVTASPSLAEQYLDFASYGFHVISANKLAGASSSNNYRQIRDAFAKTGRHWLY
NATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTLSWLFLQFDGSVPFTELVDQAWQQGL
TEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQVRVESLVPAGAESGSVDQFFENGEALN
QQMIQRLEAAKEMGLVLRYVARFDANGKARVGVEAVRTDHPLASLLPCDNVFAIESRWYR
DNPLVIRGPGAGRDVTAGAIQSDLNRLSQLL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaacagcggtagcagcggcggcaacgggccgtcaactgcataaatttggtggc
agtagccttgcggatgtgaagtgttatctacgggtggctaatattatggccaactacagt
caccccggcgatctcatggtggtgtctgctgccgggagcacgacaaaccagttgatcagt
tggttgaaactcagtcaaaacgaccgtctttctgctcatcaggtacagcaaagtctgcgt
cgttatcaacacgatctgatcaatggcttattgcctccagaaatggcagagccattaatc
agtgagtttattcatgatttagagcgcctggcgggcttgctggataataaaattgatgat
gtgatttatgctgaagtggttggtcatggtgaaatttggtcagcccgcttgatgtctgcg
ctactgaataagttggatatggatgccgtctggcttgacgcccgccgtttcctacgtgca
gagcgtgcagcgcaaccacaaattgatgaaagccgctcttatccgttactgcaacaatta
atggcccaacaccctcaccagcgtttggtggtgactggttttatctcgcgcaatgaggcg
ggtgaaacggtcttgcttggccgtaatggcagtgactattcggcgacgcaggtcggggca
ttggccggggccgagcgtgtcaccatctggagtgatgttgccggggtgtacagtgccgat
ccacgtaaagtgaaggacgcttgcctgctaccattattgcggttggatgaagccagtgaa
ctggcccgcctggcagcaccggtgttacatacccgcacattacaaccggtttctggtagt
gacatcgatttgcaattacgttgcagttatcagccggagcaggggtcaacccgtattgaa
cgtgtgctggcttcgggattgggtgccaagatagtgaccagccacgatgatgtttgcctg
attgaattgcagattgccagtcaccatgatttctcgttggcgcagaaagagatcgatcta
ctgctcaaacgtgcgcaaatcaaaccactggcgaccggtattcacccagatcgtaacctg
ctgcaactttgctatacctcagaagtggttaacagcgccttacgggtgttggaagatgcc
gctctgccggggaaactctctctgcgcgaagggctggcattggtcgcactggtgggggcg
ggggtgagcaagaacccacttcacagtcaccgtttctaccaacaactgaaagatcagcca
gttgagtttgtctggcaggccgaagacggtatcagtatggtggccgtcctgcgtcttggg
ccgactgagcacctgattcaagggttgcaccagtcgttgttccgggcggaaaaacgtatt
ggtctgatgctgtttggcaaaggcaacattggtgctcgctggttggagctgtttgcccgt
gagcagaaaagtctttcggcccgcagtggttttgaatttgtgctagccggggtggtcgat
agccgccgtagtctgctgagttacgatggtttggatgccagccggacgctggcattttac
aacgatgaagccaaagaacaggatgaagaatccctgttcttgtggatgcgtgcccacccg
tttgacgacctggtggtgttggatgtgaccgccagcccgtcacttgcagaacaatatctg
gattttgccagttatggtttccacgttatcagcgcgaacaaattagcgggggcttcaagc
agcaataattaccgccaaatccgcgatgcgtttgcgaaaactggccgccactggttgtat
aacgccacggtaggcgcggggttaccggttaaccatacggtgcgcgatctgcgtgacagt
ggcgacagtattttagcgatcagcggtattttctctggcacgctgtcttggttattcctg
caatttgatggctcagtaccttttaccgagctggtagaccaagcctggcagcaaggtttg
accgagcctgatccaagggttgatctctctggtcaggatgtaatgcgtaagttggtgatt
ttagcccgtgaagcgggttacgacatcgaaccgaatcaggtgcgggtggagtcgttggtg
cctgctggcgcagagagtgggtcggttgatcaattctttgaaaacggcgaggcattaaat
cagcaaatgattcagcgtttagaagccgcgaaggagatgggcttggtattacgctacgtg
gcacgctttgatgctaatggtaaagcgcgggtgggcgttgaagcggtacgtaccgatcat
ccgttggcttctttgctaccgtgcgataatgtttttgctattgagagccgctggtatcgc
gataatccgttggtgattcgcggcccaggcgctggccgtgatgtgaccgctggggcgatt
caatctgatttaaaccgcctatcacaactgttgtaa

DBGET integrated database retrieval system