KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0305Help
Entry
y0305             CDS       T00092                                 

Definition
(GenBank) putative transposase
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_2 rve_3 DDE_Tnp_IS240
Motif
Other DBs
NCBI-ProteinID: AAM83896
UniProt: Q8D1L9
Position
complement(326762..327361)
Genome map
AA seq 199 aa AA seqDB search
MNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLKWCTDVTEFRVGAQKLYLS
VIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGLMLHSDQGWHYRTPMWRSML
VEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDSATVLKRDIVEYIHYYNTERI
SLKTGGMSPAEYRTQVEKQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcacgggttactcagcctcattcggcggaaaaaatatcgctcctatagggcc
gatggtggccgggcatccgataatctattggctcgtaattttacatccgaaatcagtgga
ttgaagtggtgtacagatgtcacagagttccgagttggagcacagaagctgtatttgtcg
gtgatacaagacctgtttaataatgagattatttcttggcatatgtcagaaagagcagca
ttaatcctgacgtgcaagacgctggaaaaagcgctgaaagtgaaagggagaaaagaaggc
ctgatgttgcacagcgatcagggctggcattaccgaacgccgatgtggcgctcaatgctt
gtcgaggcggggataaggcaaagtatgtcacgcaaaggcaattgtttagataatgcagtg
atggaaaatttcttcagtcacctgaaagccgagatgtatcaccgtaagaagtacgattca
gccacagttttaaagcgtgacattgtagaatatatccattattacaatacagagcgcatt
agcctgaaaacaggcggaatgagtccggcagaataccggactcaggtagaaaagcagtaa

DBGET integrated database retrieval system