KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0309Help
Entry
y0309             CDS       T00092                                 

Gene name
argE
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00220  Arginine biosynthesis
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01130  Biosynthesis of antibiotics
ypk01210  2-Oxocarboxylic acid metabolism
ypk01230  Biosynthesis of amino acids
Module
ypk_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    y0309 (argE)
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     y0309 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AAM83900
UniProt: Q8ZA85
Position
complement(331869..333038)
Genome map
AA seq 389 aa AA seqDB search
MKMKLPPFIELYRALIATPSISAADSALDQSNEALINLLAGWFADLGFRVEIQPVPDTRH
KFNLLASIGENENGEGHGGLLLAGHTDTVPYDEGRWTRDPFTLTEHDHKLYGLGTADMKG
FFAFILDAVRDIDASKLTKPLYILATADEETTMAGARYFAANTQLRPDFAIIGEPTSLQP
VRAHKGHISNAIRITGQSGHSSDPARGVNAIDLMHESITQLMALRTTLQERYHNPAFTIP
YPTMNFGHINGGDAANRICACCELHMDIRPLPGLTLSDLNELMTEALEPVSQRWPGRLSI
DELHPPIPGYECPTDHHMVGVIEKLLGERTAVVNYCTEAPFIQQVCPTLVLGPGSINQAH
QPDEFIDMAFIEPTRELIGQLVDHFCQQK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatgaaattacctccatttattgagctgtaccgggcgttaattgcaacgccttcg
atcagcgccgctgatagtgccctcgaccaaagtaatgaggcattaatcaatttgttagcc
ggatggtttgcagacctgggttttcgcgtcgagatccagccggtgcctgatactcgccac
aaatttaacctgttagccagcattggcgaaaatgaaaacggggaaggtcatggcgggtta
ttgctggcgggtcataccgatactgtcccttacgatgaagggcgctggacccgcgatccc
ttcaccttgaccgagcatgaccataaactctatggcttgggtaccgcagatatgaaaggc
ttttttgcttttattctggatgcggtgcgcgatattgatgccagcaagttgaccaaaccg
ctctatattttggcaactgccgatgaagagaccaccatggcaggtgcgcgttattttgct
gcgaatacccagctacgccctgatttcgcgattatcggcgagccaacctcactgcaacct
gtccgtgcgcacaaaggccatatctccaacgccattcgtattaccggccagtctgggcac
tccagtgatccggcccggggggtgaatgccattgatttgatgcatgaatctattacgcaa
ttgatggcgctgcgtaccacactgcaagagcgttatcacaatccagcgtttactattcct
tatcccaccatgaattttggtcatattaatggcggtgatgcggcaaaccgtatctgtgcg
tgttgtgaattacatatggatatccgtccgttaccgggcctgacattaagtgatttaaat
gagttaatgaccgaagcgctggaaccggtgagtcaacgctggccggggcgtctcagtatt
gatgagttgcaccctccgatccctggctatgagtgcccaacagaccatcatatggtcggc
gtgatcgagaaactgctcggtgagcgcactgcggtggtgaactattgcaccgaagcccct
tttattcagcaagtctgcccgacattagtgctggggccaggttcgattaatcaggcacat
cagccagatgaatttattgatatggcctttatcgaaccaacacgtgagctgattggtcag
ctagttgaccacttttgccagcagaaataa

DBGET integrated database retrieval system