KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0318Help
Entry
y0318             CDS       T00092                                 

Definition
(GenBank) putative pyridine nucleotide-disulphide oxidoreductase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00010  Glycolysis / Gluconeogenesis
ypk00020  Citrate cycle (TCA cycle)
ypk00260  Glycine, serine and threonine metabolism
ypk00280  Valine, leucine and isoleucine degradation
ypk00620  Pyruvate metabolism
ypk00630  Glyoxylate and dicarboxylate metabolism
ypk00640  Propanoate metabolism
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
ypk01130  Biosynthesis of antibiotics
ypk01200  Carbon metabolism
Module
ypk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    y0318
   00020 Citrate cycle (TCA cycle)
    y0318
   00620 Pyruvate metabolism
    y0318
   00630 Glyoxylate and dicarboxylate metabolism
    y0318
   00640 Propanoate metabolism
    y0318
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y0318
   00280 Valine, leucine and isoleucine degradation
    y0318
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ypk04147]
    y0318
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     y0318
Exosome [BR:ypk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   y0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 GIDA K_oxygenase Pyr_redox AlaDh_PNT_C DAO HI0933_like FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AAM83909
UniProt: Q0WA96
Position
complement(345061..346524)
Genome map
AA seq 487 aa AA seqDB search
MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEA
VHQIEKAPGFGIHPQGKPLINGREVMDRVKRERDRFVGFVLESVETIPAADKIQGYARFI
DDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNELGDRLIINDDVFNWDDLPESV
AVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRDYAAKTLGDEFYLDPDVKV
ELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDKLGLENTSLILDERGVPQAD
RLTMQTNVPHIFIAGDASNQLPLLHEASDQARIAGVNAGGFPEVVPGLRRSPISVVFSDP
QIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVMLKNKGILRIYGEQGTGRFLGAE
MMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEEGLRTALRDLQSKLKLGADEAER
CLRCPGE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccttaaacgttgatgtcgctgttattggcggcggaacggccggactgggcgct
tatcgcgcggccaaactgttgacccccaacgtagtgatgattgaaggtggtgaatatggt
accacctgcgcacgcgtcggctgcatgccatccaaactattgattgcggcggctgaagcc
gtccaccagatagaaaaagcgcccggatttggtattcacccacaaggtaagcccctgatt
aatggccgtgaagtcatggaccgcgttaagcgtgaacgtgaccgttttgtgggcttcgta
ttggaaagcgtagagaccattcctgcggccgataaaattcaaggttatgcccgttttatt
gatgataacaccctgcaagttgatgatcacacgcagcttacttcacaaaaaatcattgcg
cagcggatcgtgattgcgacaggttcccgcccaagctggcccgcctcttggaatgagcta
ggtgaccggttgattattaatgatgacgtctttaattgggacgatctgccagaatctgtg
gcagtttttggcccaggcgttattggcttagaacttggtcaggcactgcaccggttaggt
gtccaggtaaaaatgtttggtgtcggtggtgccgttggcccgctgaccgacagtatcgtg
cgtgactacgcagcaaaaacgttgggtgatgagttctatcttgatcccgatgtaaaagtt
gagctgatgcaacgtgagggagataaagtctttatccgttatctggataaaagcggtagg
ccacaggagattatggtggactacgtcttagccgccacgggccgccgccctaatgtagat
aaattggggctggagaatacgtcactcattctggatgaacgcggagtgccgcaggcagac
cgcctgaccatgcaaaccaacgtgccgcatatttttattgcaggtgatgccagcaatcag
ttgccattactgcatgaagccagcgatcaggcacgtattgccggtgtaaatgcgggagga
ttccctgaggttgtacccggtttacgccgtagcccaatttcagtcgtgttctctgaccca
caaattgccatggtgggggcaaccttccgtgagctagcacaaaaattcagcgcttgtggt
tgctttgagattggcgaagtctcctttgagaatcaaggtcgctcgcgggtgatgctaaaa
aacaaaggcattttacgcatttatggcgaacagggcactggccgattcttaggggcagag
atgatggggccaagtgcggagcacatcgcccacttactggcatgggcgcatcagcaacaa
atgaccatcgaccagatgctcgatatgccgttttatcatccggtcattgaagaaggcctg
cgtaccgcattgcgtgatttgcaatctaagttaaagctgggcgctgatgaagcggagcgc
tgcctacgctgccctggcgaataa

DBGET integrated database retrieval system