KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0324Help
Entry
y0324             CDS       T00092                                 

Gene name
trmA
Definition
(GenBank) tRNA (uracil-5-)-methyltransferase
  KO
K00557  tRNA (uracil-5-)-methyltransferase [EC:2.1.1.35]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ypk03016]
    y0324 (trmA)
Enzymes [BR:ypk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.35  tRNA (uracil54-C5)-methyltransferase
     y0324 (trmA)
Transfer RNA biogenesis [BR:ypk03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    y0324 (trmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_U5-meth_tr Methyltransf_25 Methyltransf_4 Cons_hypoth95 Methyltransf_15 MTS Methyltransf_11 Methyltransf_31 PrmA DREV ABC_transp_aux
Motif
Other DBs
NCBI-ProteinID: AAM83915
UniProt: Q8ZAA0
Position
complement(351204..352307)
Genome map
AA seq 367 aa AA seqDB search
MTPNILPIESYDHQLAEKSARLKAMMLPFQAPEPEIFRSPADHYRMRAEFRVWHDEDDLY
HIMFDQQTKQRIRVEQFPVASRLINRLMDALMTAIRAEPLLRRKLFQIDYLSTLSGKLIA
SLLYHRQLDEEWQQKALELRDQLRAQGFDLQLIGRAAKTKIMLDHDYIDEVLPVAGREMI
YRQVENSFTQPNAAVNIHMLEWALDVTQGATGDLLELYCGNGNFSLALARNFERVLATEI
AKPSVAAAQYNIAANNIDNVQIIRMSAEEFTQAMQGVREFNRLKGIDLGSYNCETIFVDP
PRSGLDHETVKLVQAYPRILYISCNPETLCANLEQLQHTHKISRLALFDQFPYTHHMECG
VLLEKRH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgactcccaacatcctgccgattgaaagctacgaccaccaactggcagaaaagtctgcc
cgtcttaaggcgatgatgttgccatttcaggcacccgagccagaaatatttcgttctccg
gcagaccattaccgtatgagagccgaatttcgcgtttggcatgatgaagatgacttgtac
cacatcatgtttgaccaacagaccaagcaacgtatccgggttgaacaattcccggtagcc
agtcggttaatcaatcgcttaatggatgctctgatgaccgccatcagagcggagccgcta
ttgcgacgcaaactgttccaaatagattatttatctaccctcagcggtaagctgatcgcc
tcgttgctgtatcaccgccaattagatgaagagtggcagcaaaaagcgctggaactgcga
gatcagttacgtgcacaaggttttgacctacaactcattggtcgagcagctaaaactaaa
atcatgctggatcacgattatatcgatgaggtcttgccagtcgccggacgcgagatgatc
tatcggcaggttgaaaatagttttacccaacctaatgcggcggtgaatattcacatgttg
gaatgggcgctggatgttacccaaggtgccactggcgatttactggagttgtattgtggt
aacggtaatttctcattggcactggcgcgaaattttgaacgggtgctggcaacagaaatt
gccaaaccttccgtcgcagcggctcaatataatattgcagcaaataatatcgataacgtg
cagattatccggatgtcagcggaagagtttactcaggcgatgcagggcgttcgtgagttt
aaccgcctgaagggtattgatttgggcagttataattgcgagaccatctttgtcgatccg
ccacgcagtgggctggatcacgagacggttaagctagtacaggcttacccgcgtattctt
tatatctcctgtaatccagagacgctgtgcgccaatttggaacaattacagcacacacat
aaaattagccgactagcactgttcgatcaattcccttatacccaccatatggaatgtggg
gtactgctggaaaaacgtcactga

DBGET integrated database retrieval system