KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0329Help
Entry
y0329             CDS       T00092                                 

Definition
(GenBank) putative ATP-binding component of ATP transport system
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    y0329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypk02000]
    y0329
Enzymes [BR:ypk01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     y0329
Transporters [BR:ypk02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    y0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_23 ABC_ATPase AAA_30 MMR_HSR1 TsaE FeoB_N AAA_16 Ploopntkinase3 AAA_15 IstB_IS21 DUF815 DUF2813 DLIC AAA_27 AAA_22
Motif
Other DBs
NCBI-ProteinID: AAM83920
UniProt: A0A2S9PH09
Position
363372..364862
Genome map
AA seq 496 aa AA seqDB search
MEILLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKSTLIKALTGVYKRSAGE
VLLDGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFIGREPLRWGLIDHNKMNQQ
AAKLLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAKVLILDEPTASLDAKEVSMLL
DILCQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKLVGTKTVAELPRIELVQMMLGHS
FDEQLLKRGEHSITNKNPLVEFKNYGRRGVVENFDLSVSPGEIVGLAGLLGSGRTETAQL
IFGITTPDTGEAKIQGKPVKIRTPRKASKFGFGYCPEDRKTEGIVGAATVRENIILALQA
QRGWLRPLSMREQTQIADDFIQQLGIRTPSPEQQIQYLSGGNQQKVLLARWLATKPRFLI
LDEPTRGIDVGAHAEIIRLIEKLCDEGLALLIISSELEELAGYADRIIVLRDRRHVAQLD
HDEISVPAIMQAIAVQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaatattgttagaagtccgtggcttatctgttgagtttcctggtgttaaggcattg
gactccgtagatttttctctgcaacgcggtgaggttgttgcgttattaggagagaatggc
gcaggaaaatcgacattaataaaagcattaaccggggtttataaacgatccgctggtgag
gtgctgttggacggcaaggctgtgtgccccattgataccgcagatgcccaactcatgggg
attggtactgtctatcaagaggtcaacttactgccgaacatatctgttgctgcgaattta
tttattggccgtgagccgctacgttgggggctaattgatcacaataaaatgaaccagcaa
gcagcaaaattgctgacgggttatggtttaacgttagatgttcagcagcctttggctaat
ttctctattgcaatacaacagattgtagcaatcgcccgcgccgttgacctttccgcgaag
gtgctgattctggatgagcctacagcaagtttagatgctaaagaagtcagtatgttactg
gatatcttgtgccagctacgggaccagggtatcggtatggtttttgtgacccattttctc
gatcaggtttatcgaatcagtgatcgcattacagttttgcgaaatggcaagctcgtcggt
accaaaactgtggcagaacttccccggattgagctagtgcaaatgatgctggggcatagt
tttgatgaacaattactgaaacgtggtgaacacagtattacgaataagaatccattggtt
gagtttaaaaactatggccgacggggtgtggtagagaattttgatttgtctgtatctccc
ggtgaaattgtcgggttggccgggttattaggttcaggacggactgaaacagcacagcta
atttttggcataacgacacctgatacgggggaagccaaaatacaaggcaaaccggttaaa
attagaacaccacgtaaggcatcaaaatttggttttggctactgcccagaagatcgcaaa
acagagggtattgttggtgcggcaaccgtaagggaaaacatcattttagccttacaagcg
cagcgtgggtggctgaggcccctttctatgcgtgagcagacacaaattgcagacgatttt
atccagcaactgggtattcgtaccccaagccctgaacagcaaattcaatatctctccggt
ggaaaccaacaaaaagtattacttgcccgctggcttgccacgaaaccccgatttttaatt
ttagatgaaccgactcgtggtatcgatgtaggtgctcacgccgaaattattcggttgatc
gaaaagttgtgtgatgaagggttggcgctgttaattatctcttccgaattagaagaattg
gcgggttacgctgatcggatcatcgttcttcgtgatcgtcggcatgttgctcaactcgac
cacgatgaaatttccgttcctgccattatgcaggcgatcgcggtgcaataa

DBGET integrated database retrieval system