KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0329Help
Entry
y0329             CDS       T00092                                 

Definition
(GenBank) putative ATP-binding component of ATP transport system
  KO
K02056  simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Module
ypk_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypk02000]
    y0329
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     y0329
Transporters [BR:ypk02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    y0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_23 ABC_ATPase AAA_30 MMR_HSR1 TsaE FeoB_N AAA_16 DUF2813 IstB_IS21 DUF815 DLIC AAA_15 AAA_27 Zeta_toxin AAA_22
Motif
Other DBs
NCBI-ProteinID: AAM83920
UniProt: A0A0H2W745
Position
363372..364862
Genome map
AA seq 496 aa AA seqDB search
MEILLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKSTLIKALTGVYKRSAGE
VLLDGKAVCPIDTADAQLMGIGTVYQEVNLLPNISVAANLFIGREPLRWGLIDHNKMNQQ
AAKLLTGYGLTLDVQQPLANFSIAIQQIVAIARAVDLSAKVLILDEPTASLDAKEVSMLL
DILCQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKLVGTKTVAELPRIELVQMMLGHS
FDEQLLKRGEHSITNKNPLVEFKNYGRRGVVENFDLSVSPGEIVGLAGLLGSGRTETAQL
IFGITTPDTGEAKIQGKPVKIRTPRKASKFGFGYCPEDRKTEGIVGAATVRENIILALQA
QRGWLRPLSMREQTQIADDFIQQLGIRTPSPEQQIQYLSGGNQQKVLLARWLATKPRFLI
LDEPTRGIDVGAHAEIIRLIEKLCDEGLALLIISSELEELAGYADRIIVLRDRRHVAQLD
HDEISVPAIMQAIAVQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaatattgttagaagtccgtggcttatctgttgagtttcctggtgttaaggcattg
gactccgtagatttttctctgcaacgcggtgaggttgttgcgttattaggagagaatggc
gcaggaaaatcgacattaataaaagcattaaccggggtttataaacgatccgctggtgag
gtgctgttggacggcaaggctgtgtgccccattgataccgcagatgcccaactcatgggg
attggtactgtctatcaagaggtcaacttactgccgaacatatctgttgctgcgaattta
tttattggccgtgagccgctacgttgggggctaattgatcacaataaaatgaaccagcaa
gcagcaaaattgctgacgggttatggtttaacgttagatgttcagcagcctttggctaat
ttctctattgcaatacaacagattgtagcaatcgcccgcgccgttgacctttccgcgaag
gtgctgattctggatgagcctacagcaagtttagatgctaaagaagtcagtatgttactg
gatatcttgtgccagctacgggaccagggtatcggtatggtttttgtgacccattttctc
gatcaggtttatcgaatcagtgatcgcattacagttttgcgaaatggcaagctcgtcggt
accaaaactgtggcagaacttccccggattgagctagtgcaaatgatgctggggcatagt
tttgatgaacaattactgaaacgtggtgaacacagtattacgaataagaatccattggtt
gagtttaaaaactatggccgacggggtgtggtagagaattttgatttgtctgtatctccc
ggtgaaattgtcgggttggccgggttattaggttcaggacggactgaaacagcacagcta
atttttggcataacgacacctgatacgggggaagccaaaatacaaggcaaaccggttaaa
attagaacaccacgtaaggcatcaaaatttggttttggctactgcccagaagatcgcaaa
acagagggtattgttggtgcggcaaccgtaagggaaaacatcattttagccttacaagcg
cagcgtgggtggctgaggcccctttctatgcgtgagcagacacaaattgcagacgatttt
atccagcaactgggtattcgtaccccaagccctgaacagcaaattcaatatctctccggt
ggaaaccaacaaaaagtattacttgcccgctggcttgccacgaaaccccgatttttaatt
ttagatgaaccgactcgtggtatcgatgtaggtgctcacgccgaaattattcggttgatc
gaaaagttgtgtgatgaagggttggcgctgttaattatctcttccgaattagaagaattg
gcgggttacgctgatcggatcatcgttcttcgtgatcgtcggcatgttgctcaactcgac
cacgatgaaatttccgttcctgccattatgcaggcgatcgcggtgcaataa

DBGET integrated database retrieval system