KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0331Help
Entry
y0331             CDS       T00092                                 

Definition
(GenBank) putative ABC transporter permease protein
  KO
K02057  simple sugar transport system permease protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Module
ypk_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ypk02000]
    y0331
Transporters [BR:ypk02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    y0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: AAM83922
UniProt: A0A0H2W802
Position
365893..366885
Genome map
AA seq 330 aa AA seqDB search
MLKRNVPLLITIAVFILGYAFCLSQFPSFSSSRVWCDLLTDNAFLGIVAVGMTFVILSGG
IDLSVGSVIAFTGVLLAKLIGTYGIHPVYAFAIVLVMGAMFGALMGWIIDSLKLPAFIIT
LAGMFFIRGMSFIVSEESLPINHPIYETLANYAWRVPGGGRFTLLAFIMLMVVAFGILLA
HHTRFGHNVYAIGGNSVSAGLMGVPVRRTTIKIYMLSSTLAALSGIVFSLYTSAGYALAA
SGVELDAIAAVVIGGTLLAGGIGTVFGTLFGVLIQGLIQSYITFDGTLSSWWTKIVIGIL
LFSFIVIQKAMSAFYLNRRSRPQSSPLTPV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcgtaatgttcccttgctgattactatcgccgtttttattctgggatatgct
ttctgtctgagtcaatttcccagtttctcctcctctcgagtatggtgtgatttactgact
gataatgcttttcttggcattgttgctgtcggcatgactttcgttattttatcggggggg
atcgatttatctgtcggctcggttattgcctttactggtgtgctgctggctaagttaatt
ggtacctatggtattcatccagtctatgcctttgctatcgtcttagttatgggcgcaatg
tttggtgcgttgatggggtggattattgattccctgaaacttccagcgtttatcattact
cttgcagggatgttttttatccgtggtatgagttttatcgtttctgaagagtcgctgccg
attaaccacccgatatatgaaacgttggctaattatgcctggcgtgttcctgggggtggg
cgatttaccttgttagcatttattatgctgatggttgtagcttttggcatccttttggct
catcacactcgttttggtcataacgtttatgcgattggcggtaatagtgtttctgcgggg
ttgatgggtgtcccggtcaggagaacgaccattaaaatttatatgctatccagtacattg
gccgcattatcaggcattgttttctctctctacacgtctgcgggttatgcgttggcggcc
agtggtgttgagttagatgctattgctgcggttgtcattggtggcacattactggcgggc
ggtatcggtacggtattcggtacgttgttcggtgtgttaattcagggcctgatacagagt
tatattactttcgacggtacactcagctcgtggtggaccaaaattgtgattggtattttg
ctctttagctttatcgtgattcagaaagcgatgagcgctttttatctcaaccgcagatca
cgccctcagtcatcgccacttactcccgtgtaa

DBGET integrated database retrieval system