KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0332Help
Entry
y0332             CDS       T00092                                 

Definition
(GenBank) hypothetical protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: AAM83923
UniProt: Q8ZAA7
Position
complement(366872..367753)
Genome map
AA seq 293 aa AA seqDB search
MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGANLFTRHRNNIRLTPA
GERLVPYAEMLLNTWRLAKKEVIHSLQHTELSIGATASLWEAYLTPWLQQLYEQQEELRL
EARIALRNSLVKQLHERQLDLLITTEPPKMDELACLLLGHFSLRLYSSFSLDLPKEDDTP
NEHKNASEVPYIKLEWGADFHQQENRLLDSEQAPILTTTSAHLTRQLLETTGGCAFLPEH
WQKEYPQLVIHPDIPPIVRPLYAVWLQNSDQQALIRQLLKTPMNNATQSVTRE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtggataccgaattactgaaaacctttttagaggtcagtagaactcgtcactttggtcgc
gcagctgaatctctgtacttaacacagtcggcggtaagtttccgtatccgtcagttggaa
aatcaattaggtgcaaacttattcactcggcatcgtaataatattcgtctcactcctgcg
ggtgaacggctggttccgtacgcagaaatgctgctgaacacttggcgattagccaaaaaa
gaagtcatacattcgctacaacacactgagttatccataggtgcaaccgcatccctttgg
gaggcgtacctcactccatggttgcaacagttatatgaacaacaagaggaactacgcctt
gaagcacgcattgcgctgagaaactcactggtgaagcagttgcacgaacggcaactggac
ttgttgatcacgacagaaccgcccaaaatggatgaactggcctgcctgctattaggccat
ttttcactgcggctttattcgtcgttctcccttgatttaccaaaagaagatgacaccccg
aacgagcataaaaatgcaagtgaagtgccttatatcaaacttgaatggggggctgatttc
catcagcaggaaaaccgtttacttgatagtgagcaggcgccaatcctcacaacgacctct
gcccatttaacccgccagttgcttgaaacgactggcggttgcgcttttctgcctgaacat
tggcaaaaagaatacccacagcttgtcattcatcctgacattccaccgatcgtgcggcca
ctgtatgccgtttggctacaaaacagtgaccagcaagcattgatcagacaactcttaaaa
acccccatgaataacgcgacccagagcgttacacgggagtaa

DBGET integrated database retrieval system